eF-site ID 1hr0-D
PDB Code 1hr0
Chain D

click to enlarge
Title CRYSTAL STRUCTURE OF INITIATION FACTOR IF1 BOUND TO THE 30S RIBOSOMAL SUBUNIT
Classification RIBOSOME
Compound 16S RIBOSOMAL RNA
Source ORGANISM_SCIENTIFIC: Thermus thermophilus;
Sequence D:  GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPG
QHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEE
ASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLV
RHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQN
LEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVQEN
LVIEFYSR
Description (1)  30S RIBOSOMAL SUBUNIT, INITIATION FACTOR 1


Functional site

1) chain D
residue 9
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : GC4

2) chain D
residue 12
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : GC4

3) chain D
residue 26
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : GC4

4) chain D
residue 31
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : GC4

5) chain D
residue 9
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1

6) chain D
residue 12
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1

7) chain D
residue 26
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1

8) chain D
residue 31
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links