eF-site ID 1hov_9-A
PDB Code 1hov
Model 9
Chain A

click to enlarge
Title SOLUTION STRUCTURE OF A CATALYTIC DOMAIN OF MMP-2 COMPLEXED WITH SC-74020
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound MATRIX METALLOPROTEINASE-2
Source Homo sapiens (Human) (MMP2_HUMAN)
Sequence A:  MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAF
QVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKD
GLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAH
EFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQE
LYG
Description (1)  MATRIX METALLOPROTEINASE-2


Functional site

1) chain A
residue 70
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 165
source : AC1

2) chain A
residue 72
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN A 165
source : AC1

3) chain A
residue 85
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 165
source : AC1

4) chain A
residue 98
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 165
source : AC1

5) chain A
residue 120
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 166
source : AC2

6) chain A
residue 124
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 166
source : AC2

7) chain A
residue 130
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 166
source : AC2

8) chain A
residue 77
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 167
source : AC3

9) chain A
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA A 167
source : AC3

10) chain A
residue 79
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CA A 167
source : AC3

11) chain A
residue 80
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 167
source : AC3

12) chain A
residue 82
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CA A 167
source : AC3

13) chain A
residue 100
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 167
source : AC3

14) chain A
residue 103
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CA A 167
source : AC3

15) chain A
residue 60
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 168
source : AC4

16) chain A
residue 92
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA A 168
source : AC4

17) chain A
residue 93
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CA A 168
source : AC4

18) chain A
residue 94
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA A 168
source : AC4

19) chain A
residue 95
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA A 168
source : AC4

20) chain A
residue 96
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 168
source : AC4

21) chain A
residue 81
type
ligand
sequence G
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

22) chain A
residue 82
type
ligand
sequence L
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

23) chain A
residue 83
type
ligand
sequence L
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

24) chain A
residue 84
type
ligand
sequence A
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

25) chain A
residue 85
type
ligand
sequence H
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

26) chain A
residue 120
type
ligand
sequence H
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

27) chain A
residue 121
type
ligand
sequence E
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

28) chain A
residue 124
type
ligand
sequence H
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

29) chain A
residue 130
type
ligand
sequence H
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

30) chain A
residue 136
type
ligand
sequence A
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

31) chain A
residue 137
type
ligand
sequence L
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

32) chain A
residue 139
type
ligand
sequence A
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

33) chain A
residue 141
type
ligand
sequence I
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

34) chain A
residue 142
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

35) chain A
residue 143
type
ligand
sequence T
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

36) chain A
residue 145
type
ligand
sequence T
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

37) chain A
residue 148
type
ligand
sequence F
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

38) chain A
residue 149
type
ligand
sequence R
description BINDING SITE FOR RESIDUE I52 A 800
source : AC5

39) chain A
residue 26
type METAL
ligand
sequence D
description Calcium 1 (By similarity)
source Swiss-Prot : SWS_FT_FI3

40) chain A
residue 101
type METAL
ligand
sequence D
description Calcium 1 (By similarity)
source Swiss-Prot : SWS_FT_FI3

41) chain A
residue 60
type METAL
ligand
sequence D
description Calcium 2 (By similarity)
source Swiss-Prot : SWS_FT_FI4

42) chain A
residue 96
type METAL
ligand
sequence D
description Calcium 2 (By similarity)
source Swiss-Prot : SWS_FT_FI4

43) chain A
residue 70
type METAL
ligand
sequence H
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI5

44) chain A
residue 72
type METAL
ligand
sequence D
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI5

45) chain A
residue 85
type METAL
ligand
sequence H
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI5

46) chain A
residue 98
type METAL
ligand
sequence H
description Zinc 1 (By similarity)
source Swiss-Prot : SWS_FT_FI5

47) chain A
residue 77
type METAL
ligand
sequence D
description Calcium 3 (By similarity)
source Swiss-Prot : SWS_FT_FI6

48) chain A
residue 100
type METAL
ligand
sequence D
description Calcium 3 (By similarity)
source Swiss-Prot : SWS_FT_FI6

49) chain A
residue 103
type METAL
ligand
sequence E
description Calcium 3 (By similarity)
source Swiss-Prot : SWS_FT_FI6

50) chain A
residue 78
type METAL
ligand
sequence G
description Calcium 3; via carbonyl oxygen (By similarity)
source Swiss-Prot : SWS_FT_FI7

51) chain A
residue 92
type METAL
ligand
sequence G
description Calcium 2; via carbonyl oxygen (By similarity)
source Swiss-Prot : SWS_FT_FI8

52) chain A
residue 94
type METAL
ligand
sequence G
description Calcium 2; via carbonyl oxygen (By similarity)
source Swiss-Prot : SWS_FT_FI8

53) chain A
residue 117-126
type prosite
ligand
sequence VAAHEFGHAM
description Neutral zinc metallopeptidases, zinc-binding region signature. [GSTALIVN]-{PCHR}-{KND}-H-E-[LIVMFYW]-{DEHRKP}-H-{EKPC}-[LIVMFYWGSPQ]
source prosite : PS00142

54) chain A
residue 8
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence K
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

55) chain A
residue 20
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence I
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

56) chain A
residue 24
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence T
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

57) chain A
residue 27
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence L
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

58) chain A
residue 32
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence V
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

59) chain A
residue 35-36
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence AF
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

60) chain A
residue 38-43
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence RAFQVW
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

61) chain A
residue 61-66
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence IMINFG
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

62) chain A
residue 70
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence H
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

63) chain A
residue 72
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence D
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

64) chain A
residue 80-90
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence DGLLAHAFAPG
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

65) chain A
residue 92-100
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence GVGGDSHFD
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

66) chain A
residue 105-107
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence WTN
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

67) chain A
residue 111-130
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence NYSLFLVAAHEFGHAMGLEH
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

68) chain A
residue 134-145
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence PGALMAPIYTYT
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

69) chain A
residue 148-151
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence FRLS
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

70) chain A
residue 153-154
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence DD
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

71) chain A
residue 37
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence A
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

72) chain A
residue 44-46
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence SDV
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

73) chain A
residue 51
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence F
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

74) chain A
residue 75-79
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence PFDGK
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

75) chain A
residue 131-133
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence SQD
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

76) chain A
residue 146
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence K
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

77) chain A
residue 152
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence Q
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

78) chain A
residue 155
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence I
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

79) chain A
residue 18
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence Y
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

80) chain A
residue 23
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence Y
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

81) chain A
residue 26
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence D
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

82) chain A
residue 31
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence T
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

83) chain A
residue 33-34
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence DD
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

84) chain A
residue 74
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence Y
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

85) chain A
residue 102-104
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence DEL
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

86) chain A
residue 108-110
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence TSA
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

87) chain A
residue 147
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence N
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

88) chain A
residue 49
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence L
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

89) chain A
residue 73
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence G
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

90) chain A
residue 101
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence D
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

91) chain A
residue 67-68
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence RW
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

92) chain A
residue 156-158
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence KGI
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

93) chain A
residue 160-161
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence EL
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

94) chain A
residue 69
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence E
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

95) chain A
residue 71
type binding
ligand I52: N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE
sequence G
description N-{4-[(1-HYDROXYCARBAMOYL-2-METHYL-PROPYL)-(2-MORPHOLIN-4-YL-ETHYL)-SULFAMOYL]-4-PENTYL-BENZAMIDE binding site
source pdb_hetatom : I52_1hov_A_800

96) chain A
residue 11
type binding
ligand CA: CALCIUM ION
sequence W
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

97) chain A
residue 20-23
type binding
ligand CA: CALCIUM ION
sequence IIGY
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

98) chain A
residue 59-62
type binding
ligand CA: CALCIUM ION
sequence ADIM
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

99) chain A
residue 64-65
type binding
ligand CA: CALCIUM ION
sequence NF
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

100) chain A
residue 74
type binding
ligand CA: CALCIUM ION
sequence Y
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

101) chain A
residue 90
type binding
ligand CA: CALCIUM ION
sequence G
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

102) chain A
residue 92-96
type binding
ligand CA: CALCIUM ION
sequence GVGGD
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

103) chain A
residue 19
type binding
ligand CA: CALCIUM ION
sequence R
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

104) chain A
residue 24-25
type binding
ligand CA: CALCIUM ION
sequence TP
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

105) chain A
residue 63
type binding
ligand CA: CALCIUM ION
sequence I
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

106) chain A
residue 97
type binding
ligand CA: CALCIUM ION
sequence S
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

107) chain A
residue 99
type binding
ligand CA: CALCIUM ION
sequence F
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

108) chain A
residue 101
type binding
ligand CA: CALCIUM ION
sequence D
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

109) chain A
residue 66-67
type binding
ligand CA: CALCIUM ION
sequence GR
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

110) chain A
residue 70-71
type binding
ligand CA: CALCIUM ION
sequence HG
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

111) chain A
residue 89
type binding
ligand CA: CALCIUM ION
sequence P
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

112) chain A
residue 133
type binding
ligand CA: CALCIUM ION
sequence D
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

113) chain A
residue 136
type binding
ligand CA: CALCIUM ION
sequence A
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

114) chain A
residue 140
type binding
ligand CA: CALCIUM ION
sequence P
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

115) chain A
residue 153
type binding
ligand CA: CALCIUM ION
sequence D
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

116) chain A
residue 68-69
type binding
ligand CA: CALCIUM ION
sequence WE
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

117) chain A
residue 87
type binding
ligand CA: CALCIUM ION
sequence F
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

118) chain A
residue 98
type binding
ligand CA: CALCIUM ION
sequence H
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

119) chain A
residue 156
type binding
ligand CA: CALCIUM ION
sequence K
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

120) chain A
residue 132
type binding
ligand CA: CALCIUM ION
sequence Q
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

121) chain A
residue 9-10
type binding
ligand CA: CALCIUM ION
sequence PK
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

122) chain A
residue 12
type binding
ligand CA: CALCIUM ION
sequence D
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

123) chain A
residue 91
type binding
ligand CA: CALCIUM ION
sequence T
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

124) chain A
residue 134-135
type binding
ligand CA: CALCIUM ION
sequence PG
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

125) chain A
residue 79-81
type binding
ligand CA: CALCIUM ION
sequence KDG
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

126) chain A
residue 88
type binding
ligand CA: CALCIUM ION
sequence A
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

127) chain A
residue 103
type binding
ligand CA: CALCIUM ION
sequence E
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

128) chain A
residue 112
type binding
ligand CA: CALCIUM ION
sequence Y
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

129) chain A
residue 27
type binding
ligand CA: CALCIUM ION
sequence L
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

130) chain A
residue 31
type binding
ligand CA: CALCIUM ION
sequence T
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

131) chain A
residue 72-73
type binding
ligand CA: CALCIUM ION
sequence DG
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

132) chain A
residue 104-111
type binding
ligand CA: CALCIUM ION
sequence LWTNTSAN
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

133) chain A
residue 141
type binding
ligand CA: CALCIUM ION
sequence I
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_168

134) chain A
residue 62-63
type binding
ligand ZN: ZINC ION
sequence MI
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

135) chain A
residue 66
type binding
ligand ZN: ZINC ION
sequence G
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

136) chain A
residue 70
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

137) chain A
residue 72
type binding
ligand ZN: ZINC ION
sequence D
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

138) chain A
residue 85-87
type binding
ligand ZN: ZINC ION
sequence HAF
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

139) chain A
residue 95-98
type binding
ligand ZN: ZINC ION
sequence GDSH
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

140) chain A
residue 130
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

141) chain A
residue 64-65
type binding
ligand ZN: ZINC ION
sequence NF
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

142) chain A
residue 67
type binding
ligand ZN: ZINC ION
sequence R
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

143) chain A
residue 76-77
type binding
ligand ZN: ZINC ION
sequence FD
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

144) chain A
residue 82-84
type binding
ligand ZN: ZINC ION
sequence LLA
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

145) chain A
residue 99-101
type binding
ligand ZN: ZINC ION
sequence FDD
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

146) chain A
residue 140
type binding
ligand ZN: ZINC ION
sequence P
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

147) chain A
residue 73-75
type binding
ligand ZN: ZINC ION
sequence GYP
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

148) chain A
residue 88
type binding
ligand ZN: ZINC ION
sequence A
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

149) chain A
residue 93
type binding
ligand ZN: ZINC ION
sequence V
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

150) chain A
residue 120
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

151) chain A
residue 124
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

152) chain A
residue 129
type binding
ligand ZN: ZINC ION
sequence E
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

153) chain A
residue 131
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

154) chain A
residue 138-139
type binding
ligand ZN: ZINC ION
sequence MA
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

155) chain A
residue 141
type binding
ligand ZN: ZINC ION
sequence I
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

156) chain A
residue 132
type binding
ligand ZN: ZINC ION
sequence Q
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

157) chain A
residue 71
type binding
ligand ZN: ZINC ION
sequence G
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

158) chain A
residue 94
type binding
ligand ZN: ZINC ION
sequence G
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

159) chain A
residue 80-81
type binding
ligand ZN: ZINC ION
sequence DG
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

160) chain A
residue 91
type binding
ligand ZN: ZINC ION
sequence T
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

161) chain A
residue 103
type binding
ligand ZN: ZINC ION
sequence E
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

162) chain A
residue 78-79
type binding
ligand ZN: ZINC ION
sequence GK
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

163) chain A
residue 102
type binding
ligand ZN: ZINC ION
sequence D
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

164) chain A
residue 104-105
type binding
ligand ZN: ZINC ION
sequence LW
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

165) chain A
residue 111-112
type binding
ligand ZN: ZINC ION
sequence NY
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_165

166) chain A
residue 77-83
type binding
ligand CA: CALCIUM ION
sequence DGKDGLL
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

167) chain A
residue 86-88
type binding
ligand CA: CALCIUM ION
sequence AFA
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

168) chain A
residue 93-96
type binding
ligand CA: CALCIUM ION
sequence VGGD
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

169) chain A
residue 100
type binding
ligand CA: CALCIUM ION
sequence D
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

170) chain A
residue 103
type binding
ligand CA: CALCIUM ION
sequence E
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

171) chain A
residue 105
type binding
ligand CA: CALCIUM ION
sequence W
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

172) chain A
residue 123-124
type binding
ligand CA: CALCIUM ION
sequence GH
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

173) chain A
residue 126-132
type binding
ligand CA: CALCIUM ION
sequence MGLEHSQ
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

174) chain A
residue 138
type binding
ligand CA: CALCIUM ION
sequence M
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

175) chain A
residue 76
type binding
ligand CA: CALCIUM ION
sequence F
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

176) chain A
residue 84-85
type binding
ligand CA: CALCIUM ION
sequence AH
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

177) chain A
residue 89
type binding
ligand CA: CALCIUM ION
sequence P
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

178) chain A
residue 101-102
type binding
ligand CA: CALCIUM ION
sequence DD
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

179) chain A
residue 112
type binding
ligand CA: CALCIUM ION
sequence Y
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

180) chain A
residue 125
type binding
ligand CA: CALCIUM ION
sequence A
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

181) chain A
residue 161
type binding
ligand CA: CALCIUM ION
sequence L
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

182) chain A
residue 43
type binding
ligand CA: CALCIUM ION
sequence W
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

183) chain A
residue 74-75
type binding
ligand CA: CALCIUM ION
sequence YP
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

184) chain A
residue 121-122
type binding
ligand CA: CALCIUM ION
sequence EF
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

185) chain A
residue 140
type binding
ligand CA: CALCIUM ION
sequence P
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

186) chain A
residue 162
type binding
ligand CA: CALCIUM ION
sequence Y
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

187) chain A
residue 13
type binding
ligand CA: CALCIUM ION
sequence K
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

188) chain A
residue 142
type binding
ligand CA: CALCIUM ION
sequence Y
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

189) chain A
residue 104
type binding
ligand CA: CALCIUM ION
sequence L
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

190) chain A
residue 65-70
type binding
ligand CA: CALCIUM ION
sequence FGRWEH
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

191) chain A
residue 98-99
type binding
ligand CA: CALCIUM ION
sequence HF
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

192) chain A
residue 158
type binding
ligand CA: CALCIUM ION
sequence I
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

193) chain A
residue 11
type binding
ligand CA: CALCIUM ION
sequence W
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

194) chain A
residue 111
type binding
ligand CA: CALCIUM ION
sequence N
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

195) chain A
residue 19-24
type binding
ligand CA: CALCIUM ION
sequence RIIGYT
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

196) chain A
residue 36
type binding
ligand CA: CALCIUM ION
sequence F
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

197) chain A
residue 62-64
type binding
ligand CA: CALCIUM ION
sequence MIN
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

198) chain A
residue 97
type binding
ligand CA: CALCIUM ION
sequence S
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

199) chain A
residue 114
type binding
ligand CA: CALCIUM ION
sequence L
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

200) chain A
residue 117-118
type binding
ligand CA: CALCIUM ION
sequence VA
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

201) chain A
residue 32
type binding
ligand CA: CALCIUM ION
sequence V
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

202) chain A
residue 35
type binding
ligand CA: CALCIUM ION
sequence A
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

203) chain A
residue 39
type binding
ligand CA: CALCIUM ION
sequence A
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

204) chain A
residue 71-72
type binding
ligand CA: CALCIUM ION
sequence GD
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

205) chain A
residue 115
type binding
ligand CA: CALCIUM ION
sequence F
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

206) chain A
residue 119
type binding
ligand CA: CALCIUM ION
sequence A
description CALCIUM ION binding site
source pdb_hetatom : CA_1hov_A_167

207) chain A
residue 83-87
type binding
ligand ZN: ZINC ION
sequence LAHAF
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

208) chain A
residue 97-99
type binding
ligand ZN: ZINC ION
sequence SHF
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

209) chain A
residue 115-122
type binding
ligand ZN: ZINC ION
sequence FLVAAHEF
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

210) chain A
residue 124
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

211) chain A
residue 130
type binding
ligand ZN: ZINC ION
sequence H
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

212) chain A
residue 137-138
type binding
ligand ZN: ZINC ION
sequence LM
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

213) chain A
residue 142
type binding
ligand ZN: ZINC ION
sequence Y
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

214) chain A
residue 123
type binding
ligand ZN: ZINC ION
sequence G
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

215) chain A
residue 136
type binding
ligand ZN: ZINC ION
sequence A
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

216) chain A
residue 139-141
type binding
ligand ZN: ZINC ION
sequence API
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

217) chain A
residue 143
type binding
ligand ZN: ZINC ION
sequence T
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

218) chain A
residue 82
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

219) chain A
residue 100
type binding
ligand ZN: ZINC ION
sequence D
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

220) chain A
residue 105
type binding
ligand ZN: ZINC ION
sequence W
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

221) chain A
residue 112-113
type binding
ligand ZN: ZINC ION
sequence YS
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

222) chain A
residue 129
type binding
ligand ZN: ZINC ION
sequence E
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

223) chain A
residue 131
type binding
ligand ZN: ZINC ION
sequence S
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

224) chain A
residue 144-145
type binding
ligand ZN: ZINC ION
sequence YT
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

225) chain A
residue 114
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

226) chain A
residue 43
type binding
ligand ZN: ZINC ION
sequence W
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

227) chain A
residue 125
type binding
ligand ZN: ZINC ION
sequence A
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

228) chain A
residue 128
type binding
ligand ZN: ZINC ION
sequence L
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

229) chain A
residue 81
type binding
ligand ZN: ZINC ION
sequence G
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

230) chain A
residue 64-66
type binding
ligand ZN: ZINC ION
sequence NFG
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

231) chain A
residue 101
type binding
ligand ZN: ZINC ION
sequence D
description ZINC ION binding site
source pdb_hetatom : ZN_1hov_A_166

232) chain A
residue 121
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hfs
source CSA : CSA1

233) chain A
residue 138
type catalytic
ligand
sequence M
description Annotated By Reference To The Literature 1hfs
source CSA : CSA1

234) chain A
residue 121
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hfs
source CSA : CSA2


Display surface

Download
Links