eF-site ID 1hnz-Q
PDB Code 1hnz
Chain Q

click to enlarge
Title STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH HYGROMYCIN B
Classification RIBOSOME
Compound 16S RIBOSOMAL RNA
Source ORGANISM_SCIENTIFIC: Thermus thermophilus;
Sequence Q:  PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKK
YLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGR
MDLVEKYLIRRQNYQSLSKRGGKA
Description (1)  INHIBITED 30S RIBOSOMAL SUBUNIT


Functional site

1) chain Q
residue 39
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG A 1612
source : HC2


Display surface

Download
Links