eF-site ID 1hnz-P
PDB Code 1hnz
Chain P

click to enlarge
Title STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH HYGROMYCIN B
Classification RIBOSOME
Compound 16S RIBOSOMAL RNA
Source ORGANISM_SCIENTIFIC: Thermus thermophilus;
Sequence P:  MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYD
PRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVF
RQEAREGA
Description (1)  INHIBITED 30S RIBOSOMAL SUBUNIT

Display surface

Download
Links