eF-site ID 1hnz-L
PDB Code 1hnz
Chain L

click to enlarge
Title STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH HYGROMYCIN B
Classification RIBOSOME
Compound 16S RIBOSOMAL RNA
Source ORGANISM_SCIENTIFIC: Thermus thermophilus;
Sequence L:  PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVT
PKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVL
IRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKK
PKEA
Description (1)  INHIBITED 30S RIBOSOMAL SUBUNIT


Functional site

1) chain L
residue 49
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MG A 1611
source : HC1


Display surface

Download
Links