eF-site ID 1hnz-D
PDB Code 1hnz
Chain D

click to enlarge
Title STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH HYGROMYCIN B
Classification RIBOSOME
Compound 16S RIBOSOMAL RNA
Source ORGANISM_SCIENTIFIC: Thermus thermophilus;
Sequence D:  GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPG
QHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEE
ASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLV
RHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQN
LEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR
Description (1)  INHIBITED 30S RIBOSOMAL SUBUNIT


Functional site

1) chain D
residue 82
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MG D 215
source : GC6

2) chain D
residue 83
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG D 215
source : GC6

3) chain D
residue 85
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MG D 215
source : GC6

4) chain D
residue 87
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MG D 215
source : GC6

5) chain D
residue 89
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG D 215
source : GC6

6) chain D
residue 9
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : JC5

7) chain D
residue 12
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : JC5

8) chain D
residue 19
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ZN D 300
source : JC5

9) chain D
residue 26
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : JC5

10) chain D
residue 31
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN D 300
source : JC5

11) chain D
residue 9
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1

12) chain D
residue 12
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1

13) chain D
residue 26
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1

14) chain D
residue 31
type METAL
ligand
sequence C
description Zinc (Probable)
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links