eF-site ID 1hnz-C
PDB Code 1hnz
Chain C

click to enlarge
Title STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH HYGROMYCIN B
Classification RIBOSOME
Compound 16S RIBOSOMAL RNA
Source ORGANISM_SCIENTIFIC: Thermus thermophilus;
Sequence C:  GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRG
LLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGG
ERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVA
EQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAE
QARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGEV
Description (1)  INHIBITED 30S RIBOSOMAL SUBUNIT

Display surface

Download
Links