eF-site ID 1hnx-N PDB Code 1hnx Chain N click to enlarge Title STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH PACTAMYCIN Classification RIBOSOME Compound 16S RIBOSOMAL RNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence N:  ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCR ICLRELAHKGQLPGVRKASW Description Functional site 1) chain N residue 20 type sequence A description BINDING SITE FOR RESIDUE MG A 1576 source : DC1 2) chain N residue 24 type sequence C description BINDING SITE FOR RESIDUE ZN N 190 source : JC2 3) chain N residue 27 type sequence C description BINDING SITE FOR RESIDUE ZN N 190 source : JC2 4) chain N residue 40 type sequence C description BINDING SITE FOR RESIDUE ZN N 190 source : JC2 5) chain N residue 43 type sequence C description BINDING SITE FOR RESIDUE ZN N 190 source : JC2 6) chain N residue 23-45 type prosite sequence RCVRCGRARSVYRFFGLCRICLR description RIBOSOMAL_S14 Ribosomal protein S14 signature. R.CvrcgrarsvyrfFGLCRiCLR source prosite : PS00527 7) chain N residue 24 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 8) chain N residue 27 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 9) chain N residue 40 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 10) chain N residue 43 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links