eF-site ID 1hng-B
PDB Code 1hng
Chain B

click to enlarge
Title CRYSTAL STRUCTURE AT 2.8 ANGSTROMS RESOLUTION OF A SOLUBLE FORM OF THE CELL ADHESION MOLECULE CD2
Classification T LYMPHOCYTE ADHESION GLYCOPROTEIN
Compound CD2
Source Rattus norvegicus (Rat) (CD2_RAT)
Sequence B:  DSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAE
FKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVY
STNGTRILNKALDLRILEMVSKPMIYWECSNATLTCEVLE
GTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVN
RVSQESEMEVVNCPE
Description (1)  CD2 (RAT)

Display surface

Download
Links