eF-site ID 1hgu-A PDB Code 1hgu Chain A click to enlarge Title HUMAN GROWTH HORMONE Classification HORMONE Compound HUMAN GROWTH HORMONE Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens; Sequence A:  PTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPQKYS FLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLI QSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQT LMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLL YCFRKDMDKVETFLRIVQCRSVEGSCG Description (1)  HUMAN GROWTH HORMONE Functional site 1) chain A residue 53-86 type prosite sequence CFSESIPTPSNREQAQQKSNLQLLRISLLLIQSW description SOMATOTROPIN_1 Somatotropin, prolactin and related hormones signature 1. CfSesIpTPsnreqAqqksnlqLlrisllLiqSW source prosite : PS00266 2) chain A residue 165-182 type prosite sequence CFRKDMDKVETFLRIVQC description SOMATOTROPIN_2 Somatotropin, prolactin and related hormones signature 2. CFRkDMdKVEtFlrIvqC source prosite : PS00338 3) chain A residue 18 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 174 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 106 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:14997482 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 150 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:14997482 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 137 type MOD_RES sequence Q description Deamidated glutamine; by deterioration => ECO:0000269|PubMed:7028740 source Swiss-Prot : SWS_FT_FI3 8) chain A residue 152 type MOD_RES sequence N description Deamidated asparagine; by deterioration => ECO:0000269|PubMed:7028740 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links