eF-site ID 1hcp_19-A
PDB Code 1hcp
Model 19
Chain A

click to enlarge
Title DNA RECOGNITION BY THE OESTROGEN RECEPTOR: FROM SOLUTION TO THE CRYSTAL
Classification TRANSCRIPTION REGULATION
Compound HUMAN/CHICKEN ESTROGEN RECEPTOR
Source Homo sapiens (Human) (ESR1_HUMAN)
Sequence A:  MKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHND
YMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKG
Description (1)  HUMAN/CHICKEN ESTROGEN RECEPTOR


Functional site

1) chain A
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 98
source : AC1

2) chain A
residue 10
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 98
source : AC1

3) chain A
residue 24
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 98
source : AC1

4) chain A
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 98
source : AC1

5) chain A
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 99
source : AC2

6) chain A
residue 49
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 99
source : AC2

7) chain A
residue 59
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 99
source : AC2

8) chain A
residue 62
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 99
source : AC2

9) chain A
residue 7-72
type DNA_BIND
ligand
sequence CAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPAT
NQCTIDKNRRKSCQACRLRKCYEVGM
description Nuclear receptor.
source Swiss-Prot : SWS_FT_FI1

10) chain A
residue 7-33
type prosite
ligand
sequence CAVCNDYASGYHYGVWSCEGCKAFFKR
description Nuclear hormones receptors DNA-binding region signature. C-x(2)-C-x(1,2)-[DENAVSPHKQT]-x(5,6)-[HNY]-[FY]-x(4)-C-x(2)-C-x(2)-F(2)
source prosite : PS00031

11) chain A
residue 7-12
type binding
ligand ZN: ZINC ION
sequence CAVCND
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

12) chain A
residue 23-25
type binding
ligand ZN: ZINC ION
sequence SCE
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

13) chain A
residue 27-28
type binding
ligand ZN: ZINC ION
sequence CK
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

14) chain A
residue 63
type binding
ligand ZN: ZINC ION
sequence R
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

15) chain A
residue 26
type binding
ligand ZN: ZINC ION
sequence G
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

16) chain A
residue 67
type binding
ligand ZN: ZINC ION
sequence C
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

17) chain A
residue 57
type binding
ligand ZN: ZINC ION
sequence K
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

18) chain A
residue 53-54
type binding
ligand ZN: ZINC ION
sequence KN
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

19) chain A
residue 52
type binding
ligand ZN: ZINC ION
sequence D
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

20) chain A
residue 55-56
type binding
ligand ZN: ZINC ION
sequence RR
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_98

21) chain A
residue 42-46
type binding
ligand ZN: ZINC ION
sequence MCPAT
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99

22) chain A
residue 49
type binding
ligand ZN: ZINC ION
sequence C
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99

23) chain A
residue 51
type binding
ligand ZN: ZINC ION
sequence I
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99

24) chain A
residue 58-63
type binding
ligand ZN: ZINC ION
sequence SCQACR
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99

25) chain A
residue 48
type binding
ligand ZN: ZINC ION
sequence Q
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99

26) chain A
residue 66
type binding
ligand ZN: ZINC ION
sequence K
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99

27) chain A
residue 47
type binding
ligand ZN: ZINC ION
sequence N
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99

28) chain A
residue 50
type binding
ligand ZN: ZINC ION
sequence T
description ZINC ION binding site
source pdb_hetatom : ZN_1hcp_A_99


Display surface

Download
Links