eF-site ID 1h65-C
PDB Code 1h65
Chain C

click to enlarge
Title Crystal structure of pea Toc34 - a novel GTPase of the chloroplast protein translocon
Classification GTPASE
Compound CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
Source (1H65)
Sequence C:  VREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVXGK
GGVGKSSTVNSIIGERVVSISPFQSEGPRPVXVSRSRAGF
TLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVLLYVD
RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFS
PPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVV
LIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKS
ESIFVDKNLIDKLAAA
Description (1)  CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34


Functional site

1) chain C
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG C 282
source : AC3

2) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG C 282
source : AC3

3) chain C
residue 132
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

4) chain C
residue 133
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

5) chain C
residue 169
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

6) chain C
residue 48
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

7) chain C
residue 49
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

8) chain C
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

9) chain C
residue 51
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

10) chain C
residue 52
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

11) chain C
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

12) chain C
residue 54
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

13) chain C
residue 67
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

14) chain C
residue 68
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

15) chain C
residue 69
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

16) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

17) chain C
residue 162
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

18) chain C
residue 163
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

19) chain C
residue 210
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

20) chain C
residue 211
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

21) chain C
residue 132-133
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence YR
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

22) chain C
residue 166
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence F
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

23) chain C
residue 169-170
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence PD
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

24) chain C
residue 47-54
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence KGGVGKSS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

25) chain C
residue 66-69
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence SISP
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

26) chain C
residue 73
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence E
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

27) chain C
residue 162-163
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TH
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

28) chain C
residue 209-212
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence IENS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

29) chain C
residue 97
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1ksj
source CSA : CSA3


Display surface

Download
Links