eF-site ID 1h65-ABC
PDB Code 1h65
Chain A, B, C

click to enlarge
Title Crystal structure of pea Toc34 - a novel GTPase of the chloroplast protein translocon
Classification GTPASE
Compound CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
Source (1H65)
Sequence A:  VREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVXGK
GGVGKSSTVNSIIGERVVSISPFQSEGPRPVXVSRSRAGF
TLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVLLYVD
RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFS
PPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVV
LIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKS
ESIFVDKNLIDKLAAAD
B:  TVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVXG
KGGVGKSSTVNSIIGERVVSISPFQSEGPRPVXVSRSRAG
FTLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVLLYV
DRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQF
SPPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPV
VLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNK
SESIFVDKNLIDKLAA
C:  VREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVXGK
GGVGKSSTVNSIIGERVVSISPFQSEGPRPVXVSRSRAGF
TLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVLLYVD
RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFS
PPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVV
LIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKS
ESIFVDKNLIDKLAAA
Description (1)  CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34


Functional site

1) chain A
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG A 282
source : AC1

2) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG A 282
source : AC1

3) chain B
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG B 282
source : AC2

4) chain B
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG B 282
source : AC2

5) chain C
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG C 282
source : AC3

6) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG C 282
source : AC3

7) chain A
residue 49
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

8) chain A
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

9) chain A
residue 51
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

10) chain A
residue 52
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

11) chain A
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

12) chain A
residue 54
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

13) chain A
residue 67
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

14) chain A
residue 68
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

15) chain A
residue 69
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

16) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

17) chain A
residue 132
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

18) chain A
residue 133
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

19) chain A
residue 162
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

20) chain A
residue 163
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

21) chain A
residue 169
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

22) chain A
residue 210
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

23) chain A
residue 211
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

24) chain B
residue 49
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

25) chain B
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

26) chain B
residue 51
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

27) chain B
residue 52
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

28) chain B
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

29) chain B
residue 54
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

30) chain B
residue 67
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

31) chain B
residue 68
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

32) chain B
residue 69
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

33) chain B
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

34) chain B
residue 163
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

35) chain B
residue 210
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

36) chain B
residue 211
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

37) chain C
residue 132
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

38) chain C
residue 133
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

39) chain C
residue 169
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP B 281
source : AC5

40) chain B
residue 132
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

41) chain B
residue 133
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

42) chain B
residue 169
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

43) chain C
residue 48
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

44) chain C
residue 49
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

45) chain C
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

46) chain C
residue 51
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

47) chain C
residue 52
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

48) chain C
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

49) chain C
residue 54
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

50) chain C
residue 67
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

51) chain C
residue 68
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

52) chain C
residue 69
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

53) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

54) chain C
residue 162
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

55) chain C
residue 163
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

56) chain C
residue 210
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

57) chain C
residue 211
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP C 281
source : AC6

58) chain A
residue 47-55
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence KGGVGKSST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

59) chain A
residue 66-69
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence SISP
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

60) chain A
residue 73
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence E
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

61) chain A
residue 162-164
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence THA
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

62) chain A
residue 209-212
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence IENS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

63) chain B
residue 47-55
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence KGGVGKSST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

64) chain B
residue 66-69
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence SISP
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

65) chain B
residue 73
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence E
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

66) chain B
residue 162-164
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence THA
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

67) chain B
residue 209-212
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence IENS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

68) chain B
residue 214
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence R
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

69) chain C
residue 132-133
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence YR
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

70) chain C
residue 166
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence F
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

71) chain C
residue 169-170
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence PD
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_B_281

72) chain B
residue 132-133
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence YR
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

73) chain B
residue 169-170
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence PD
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

74) chain C
residue 47-54
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence KGGVGKSS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

75) chain C
residue 66-69
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence SISP
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

76) chain C
residue 73
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence E
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

77) chain C
residue 162-163
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence TH
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

78) chain C
residue 209-212
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence IENS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_C_281

79) chain A
residue 97
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1ksj
source CSA : CSA1

80) chain B
residue 97
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1ksj
source CSA : CSA2

81) chain C
residue 97
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1ksj
source CSA : CSA3


Display surface

Download
Links