eF-site ID 1h65-A PDB Code 1h65 Chain A click to enlarge Title Crystal structure of pea Toc34 - a novel GTPase of the chloroplast protein translocon Classification GTPASE Compound CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34 Source (1H65) Sequence A:  VREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVXGK GGVGKSSTVNSIIGERVVSISPFQSEGPRPVXVSRSRAGF TLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVLLYVD RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFS PPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVV LIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKS ESIFVDKNLIDKLAAAD Description (1)  CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34 Functional site 1) chain A residue 53 type sequence S description BINDING SITE FOR RESIDUE MG A 282 source : AC1 2) chain A residue 73 type sequence E description BINDING SITE FOR RESIDUE MG A 282 source : AC1 3) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 4) chain A residue 50 type sequence V description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 5) chain A residue 51 type sequence G description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 6) chain A residue 52 type sequence K description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 7) chain A residue 53 type sequence S description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 8) chain A residue 54 type sequence S description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 9) chain A residue 67 type sequence I description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 10) chain A residue 68 type sequence S description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 11) chain A residue 69 type sequence P description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 12) chain A residue 73 type sequence E description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 13) chain A residue 132 type sequence Y description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 14) chain A residue 133 type sequence R description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 15) chain A residue 162 type sequence T description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 16) chain A residue 163 type sequence H description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 17) chain A residue 169 type sequence P description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 18) chain A residue 210 type sequence E description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 19) chain A residue 211 type sequence N description BINDING SITE FOR RESIDUE GDP A 281 source : AC4 20) chain A residue 49 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11753431 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 73 type BINDING sequence E description BINDING => ECO:0000269|PubMed:11753431 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 210 type BINDING sequence E description BINDING => ECO:0000269|PubMed:11753431 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links