eF-site ID 1h65-A
PDB Code 1h65
Chain A

click to enlarge
Title Crystal structure of pea Toc34 - a novel GTPase of the chloroplast protein translocon
Classification GTPASE
Compound CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
Source (1H65)
Sequence A:  VREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVXGK
GGVGKSSTVNSIIGERVVSISPFQSEGPRPVXVSRSRAGF
TLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVLLYVD
RLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFS
PPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVV
LIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKS
ESIFVDKNLIDKLAAAD
Description (1)  CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34


Functional site

1) chain A
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG A 282
source : AC1

2) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG A 282
source : AC1

3) chain A
residue 49
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

4) chain A
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

5) chain A
residue 51
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

6) chain A
residue 52
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

7) chain A
residue 53
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

8) chain A
residue 54
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

9) chain A
residue 67
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

10) chain A
residue 68
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

11) chain A
residue 69
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

12) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

13) chain A
residue 132
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

14) chain A
residue 133
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

15) chain A
residue 162
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

16) chain A
residue 163
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

17) chain A
residue 169
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

18) chain A
residue 210
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

19) chain A
residue 211
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GDP A 281
source : AC4

20) chain A
residue 47-55
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence KGGVGKSST
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

21) chain A
residue 66-69
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence SISP
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

22) chain A
residue 73
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence E
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

23) chain A
residue 162-164
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence THA
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

24) chain A
residue 209-212
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence IENS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_1h65_A_281

25) chain A
residue 97
type catalytic
ligand
sequence L
description Annotated By Reference To The Literature 1ksj
source CSA : CSA1


Display surface

Download
Links