eF-site ID 1h2t-Z PDB Code 1h2t Chain Z click to enlarge Title Structure of the human nuclear cap-binding-complex (CBC) in complex with a cap analogue m7GpppG Classification NUCLEAR PROTEIN Compound 80 KDA NUCLEAR CAP BINDING PROTEIN Source (CB20_HUMAN) Sequence Z:  LLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYV GNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFC FVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQ YGRGRSGGQVRDEYRQDYDAGRGGYG Description Functional site 1) chain Z residue 20 type sequence Y description BINDING SITE FOR RESIDUE GDP Z1151 source : AC1 2) chain Z residue 127 type sequence R description BINDING SITE FOR RESIDUE GDP Z1151 source : AC1 3) chain Z residue 134 type sequence V description BINDING SITE FOR RESIDUE GDP Z1151 source : AC1 4) chain Z residue 138 type sequence Y description BINDING SITE FOR RESIDUE GDP Z1151 source : AC1 5) chain Z residue 20 type sequence Y description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 6) chain Z residue 22 type sequence D description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 7) chain Z residue 43 type sequence Y description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 8) chain Z residue 83 type sequence F description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 9) chain Z residue 112 type sequence R description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 10) chain Z residue 114 type sequence D description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 11) chain Z residue 115 type sequence W description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 12) chain Z residue 116 type sequence D description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 13) chain Z residue 123 type sequence R description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 14) chain Z residue 125 type sequence Y description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 15) chain Z residue 127 type sequence R description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 16) chain Z residue 133 type sequence Q description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 17) chain Z residue 134 type sequence V description BINDING SITE FOR RESIDUE 7MG Z1152 source : AC2 18) chain Z residue 18 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:17525332 source Swiss-Prot : SWS_FT_FI5 19) chain Z residue 112 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 20) chain Z residue 123 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 21) chain Z residue 133 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI2 22) chain Z residue 13 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 23) chain Z residue 20 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12374755, ECO:0000269|PubMed:12434151 source Swiss-Prot : SWS_FT_FI1 24) chain Z residue 43 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12374755, ECO:0000269|PubMed:12434151 source Swiss-Prot : SWS_FT_FI1 25) chain Z residue 146 type MOD_RES sequence R description Omega-N-methylarginine => ECO:0007744|PubMed:24129315 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links