eF-site ID 1h26-C
PDB Code 1h26
Chain C

click to enlarge
Title CDK2/CyclinA in complex with an 11-residue recruitment peptide from p53
Classification CELL CYCLE
Compound CELL DIVISION PROTEIN KINASE 2
Source Homo sapiens (Human) (P53_HUMAN)
Sequence C:  SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDT
ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCH
SHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
XHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTR
RALFPGDSEIDQLFRIFRTLGTVVPPLDEDGRSLLSQMLH
YDPNKRISAKAALAHPFFQDVTKPVPHLR
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.-), CYCLIN A2, CELLULAR TUMOR ANTIGEN P53


Functional site

1) chain C
residue 132
type ACT_SITE
ligand
sequence N
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI4

2) chain C
residue 38
type BINDING
ligand
sequence D
description ATP.
source Swiss-Prot : SWS_FT_FI5

3) chain C
residue 91
type BINDING
ligand
sequence M
description ATP.
source Swiss-Prot : SWS_FT_FI5

4) chain C
residue 150
type BINDING
ligand
sequence R
description ATP.
source Swiss-Prot : SWS_FT_FI5

5) chain C
residue 15-23
type NP_BIND
ligand
sequence YGVVYKARN
description ATP.
source Swiss-Prot : SWS_FT_FI6

6) chain C
residue 86-88
type NP_BIND
ligand
sequence DLK
description ATP.
source Swiss-Prot : SWS_FT_FI6

7) chain C
residue 134-137
type NP_BIND
ligand
sequence LINT
description ATP.
source Swiss-Prot : SWS_FT_FI6

8) chain C
residue 131
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

9) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

10) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

11) chain C
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

12) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA6

13) chain C
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA6

14) chain C
residue 165
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1ir3
source CSA : CSA6

15) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA8

16) chain C
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA8

17) chain C
residue 132
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1ir3
source CSA : CSA8


Display surface

Download
Links