eF-site ID 1h26-ABCDE
PDB Code 1h26
Chain A, B, C, D, E

click to enlarge
Title CDK2/CyclinA in complex with an 11-residue recruitment peptide from p53
Classification CELL CYCLE
Compound CELL DIVISION PROTEIN KINASE 2
Source Homo sapiens (Human) (P53_HUMAN)
Sequence A:  SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDT
ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCH
SHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
XHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTR
RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPS
FPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKA
ALAHPFFQDVTKPVPHLR
B:  VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAIL
VDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRM
EHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE
SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNL
C:  SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDT
ETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCH
SHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
XHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTR
RALFPGDSEIDQLFRIFRTLGTVVPPLDEDGRSLLSQMLH
YDPNKRISAKAALAHPFFQDVTKPVPHLR
D:  VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAIL
VDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRM
EHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE
SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNL
E:  SRHKKLMFK
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.-), CYCLIN A2, CELLULAR TUMOR ANTIGEN P53


Functional site

1) chain A
residue 132
type ACT_SITE
ligand
sequence N
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 38
type BINDING
ligand
sequence D
description ATP.
source Swiss-Prot : SWS_FT_FI2

3) chain A
residue 91
type BINDING
ligand
sequence M
description ATP.
source Swiss-Prot : SWS_FT_FI2

4) chain A
residue 150
type BINDING
ligand
sequence R
description ATP.
source Swiss-Prot : SWS_FT_FI2

5) chain A
residue 15-23
type NP_BIND
ligand
sequence YGVVYKARN
description ATP.
source Swiss-Prot : SWS_FT_FI3

6) chain A
residue 86-88
type NP_BIND
ligand
sequence DLK
description ATP.
source Swiss-Prot : SWS_FT_FI3

7) chain A
residue 134-137
type NP_BIND
ligand
sequence LINT
description ATP.
source Swiss-Prot : SWS_FT_FI3

8) chain C
residue 132
type ACT_SITE
ligand
sequence N
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI4

9) chain C
residue 38
type BINDING
ligand
sequence D
description ATP.
source Swiss-Prot : SWS_FT_FI5

10) chain C
residue 91
type BINDING
ligand
sequence M
description ATP.
source Swiss-Prot : SWS_FT_FI5

11) chain C
residue 150
type BINDING
ligand
sequence R
description ATP.
source Swiss-Prot : SWS_FT_FI5

12) chain C
residue 15-23
type NP_BIND
ligand
sequence YGVVYKARN
description ATP.
source Swiss-Prot : SWS_FT_FI6

13) chain C
residue 86-88
type NP_BIND
ligand
sequence DLK
description ATP.
source Swiss-Prot : SWS_FT_FI6

14) chain C
residue 134-137
type NP_BIND
ligand
sequence LINT
description ATP.
source Swiss-Prot : SWS_FT_FI6

15) chain A
residue 149
type catalytic
ligand
sequence A
description Mapped from 2phk to 1h26 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

16) chain A
residue 151
type catalytic
ligand
sequence A
description Mapped from 2phk to 1h26 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

17) chain A
residue 131
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

18) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

19) chain C
residue 131
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

20) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA2

21) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

22) chain A
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

23) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

24) chain C
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA4

25) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA5

26) chain A
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA5

27) chain A
residue 165
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1ir3
source CSA : CSA5

28) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA6

29) chain C
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA6

30) chain C
residue 165
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1ir3
source CSA : CSA6

31) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA7

32) chain A
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA7

33) chain A
residue 132
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1ir3
source CSA : CSA7

34) chain C
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA8

35) chain C
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA8

36) chain C
residue 132
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1ir3
source CSA : CSA8


Display surface

Download
Links