eF-site ID 1h1o-AB PDB Code 1h1o Chain A, B click to enlarge Title Acidithiobacillus ferrooxidans cytochrome c4 structure supports a complex-induced tuning of electron transfer Classification ELECTRON TRANSPORT Compound CYTOCHROME C-552 Source ORGANISM_SCIENTIFIC: THIOBACILLUS FERROOXIDANS; Sequence A:  VSSDCMVCHGMTGRDTLYPIVPRLAGQHKSYMEAQLKAYK DHSRADQNGEIYMWPVAQALDSAKITALADYFNAQKPPMQ SSGIKHAGAKEGKAIFNQGVTNEQIPACMECHGSDGQGAG PFPRLAGQRYGYIIQQLTYFHNGTRVNTLMNQIAKNITVA QMKDVAAYLSSL B:  SSDCMVCHGMTGDTLYPIVPRLAGQHKSYMEAQLKAYKDH SRADQNGEIYMWPVAQALDSAKITALADYFNAQKPPMQSS GIKHAGAKEGKAIFNQGVTNEQIPACMECHGSDGQGAGPF PRLAGQRYGYIIQQLTYFHNGTRVNTLMNQIAKNITVAQM KDVAAYLSSL Description (1)  CYTOCHROME C-552 Functional site 1) chain A residue 98 type sequence A description BINDING SITE FOR RESIDUE SO4 A 1186 source : AC1 2) chain A residue 99 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1186 source : AC1 3) chain A residue 102 type sequence E description BINDING SITE FOR RESIDUE SO4 A 1186 source : AC1 4) chain A residue 171 type sequence A description BINDING SITE FOR RESIDUE SO4 A 1186 source : AC1 5) chain A residue 175 type sequence D description BINDING SITE FOR RESIDUE SO4 A 1186 source : AC1 6) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE ZN A 1187 source : AC2 7) chain A residue 40 type sequence K description BINDING SITE FOR RESIDUE ZN A 1187 source : AC2 8) chain A residue 84 type sequence N description BINDING SITE FOR RESIDUE ZN A 1187 source : AC2 9) chain A residue 152 type sequence H description BINDING SITE FOR RESIDUE ZN A 1189 source : AC3 10) chain A residue 117 type sequence P description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 11) chain A residue 118 type sequence A description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 12) chain A residue 121 type sequence E description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 13) chain B residue 239 type sequence H description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 14) chain B residue 240 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 15) chain B residue 241 type sequence S description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 16) chain B residue 284 type sequence N description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 17) chain B residue 331 type sequence G description BINDING SITE FOR RESIDUE SO4 B 1387 source : AC4 18) chain A residue 121 type sequence E description BINDING SITE FOR RESIDUE ZN B 1388 source : AC5 19) chain B residue 239 type sequence H description BINDING SITE FOR RESIDUE ZN B 1388 source : AC5 20) chain B residue 352 type sequence H description BINDING SITE FOR RESIDUE ZN B 1389 source : AC6 21) chain B residue 234 type sequence R description BINDING SITE FOR RESIDUE ZN B 1390 source : AC7 22) chain B residue 297 type sequence H description BINDING SITE FOR RESIDUE ZN B 1390 source : AC7 23) chain A residue 42 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 24) chain A residue 46 type sequence Q description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 25) chain A residue 117 type sequence P description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 26) chain A residue 119 type sequence C description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 27) chain A residue 122 type sequence C description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 28) chain A residue 123 type sequence H description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 29) chain A residue 134 type sequence P description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 30) chain A residue 136 type sequence L description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 31) chain A residue 143 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 32) chain A residue 148 type sequence L description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 33) chain A residue 151 type sequence F description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 34) chain A residue 156 type sequence R description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 35) chain A residue 158 type sequence N description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 36) chain A residue 161 type sequence M description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 37) chain A residue 164 type sequence I description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 38) chain A residue 168 type sequence I description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 39) chain A residue 176 type sequence V description BINDING SITE FOR RESIDUE HEM A 1184 source : AC8 40) chain A residue 15 type sequence D description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 41) chain A residue 16 type sequence C description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 42) chain A residue 19 type sequence C description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 43) chain A residue 20 type sequence H description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 44) chain A residue 31 type sequence I description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 45) chain A residue 33 type sequence P description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 46) chain A residue 42 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 47) chain A residue 47 type sequence L description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 48) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 49) chain A residue 55 type sequence R description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 50) chain A residue 57 type sequence D description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 51) chain A residue 59 type sequence N description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 52) chain A residue 60 type sequence G description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 53) chain A residue 63 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 54) chain A residue 64 type sequence M description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 55) chain A residue 67 type sequence V description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 56) chain A residue 79 type sequence L description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 57) chain A residue 143 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 58) chain A residue 147 type sequence Q description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 59) chain A residue 150 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 60) chain B residue 262 type sequence I description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 61) chain B residue 263 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1185 source : AC9 62) chain B residue 242 type sequence Y description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 63) chain B residue 246 type sequence Q description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 64) chain B residue 316 type sequence I description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 65) chain B residue 319 type sequence C description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 66) chain B residue 322 type sequence C description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 67) chain B residue 323 type sequence H description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 68) chain B residue 332 type sequence P description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 69) chain B residue 333 type sequence F description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 70) chain B residue 334 type sequence P description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 71) chain B residue 336 type sequence L description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 72) chain B residue 343 type sequence Y description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 73) chain B residue 347 type sequence Q description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 74) chain B residue 348 type sequence L description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 75) chain B residue 356 type sequence R description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 76) chain B residue 358 type sequence N description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 77) chain B residue 360 type sequence L description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 78) chain B residue 361 type sequence M description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 79) chain B residue 364 type sequence I description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 80) chain B residue 376 type sequence V description BINDING SITE FOR RESIDUE HEM B 1385 source : BC1 81) chain A residue 29 type sequence Y description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 82) chain B residue 215 type sequence D description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 83) chain B residue 216 type sequence C description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 84) chain B residue 218 type sequence V description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 85) chain B residue 219 type sequence C description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 86) chain B residue 220 type sequence H description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 87) chain B residue 231 type sequence I description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 88) chain B residue 233 type sequence P description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 89) chain B residue 235 type sequence L description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 90) chain B residue 242 type sequence Y description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 91) chain B residue 247 type sequence L description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 92) chain B residue 250 type sequence Y description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 93) chain B residue 255 type sequence R description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 94) chain B residue 257 type sequence D description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 95) chain B residue 259 type sequence N description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 96) chain B residue 260 type sequence G description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 97) chain B residue 263 type sequence Y description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 98) chain B residue 264 type sequence M description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 99) chain B residue 279 type sequence L description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 100) chain B residue 343 type sequence Y description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 101) chain B residue 347 type sequence Q description BINDING SITE FOR RESIDUE HEM B 1386 source : BC2 102) chain A residue 122 type sequence C description BINDING SITE FOR RESIDUE GOL B 1384 source : BC3 103) chain B residue 324 type sequence G description BINDING SITE FOR RESIDUE GOL B 1384 source : BC3 104) chain B residue 325 type sequence S description BINDING SITE FOR RESIDUE GOL B 1384 source : BC3 105) chain B residue 328 type sequence Q description BINDING SITE FOR RESIDUE GOL B 1384 source : BC3 106) chain A residue 19 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 107) chain A residue 119 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 108) chain A residue 122 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 109) chain B residue 216 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 110) chain B residue 219 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 111) chain B residue 319 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 112) chain B residue 322 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 113) chain A residue 16 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI1 114) chain A residue 123 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI2 115) chain B residue 220 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI2 116) chain B residue 323 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI2 117) chain A residue 20 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links