eF-site ID 1h15-A
PDB Code 1h15
Chain A

click to enlarge
Title X-ray crystal structure of HLA-DRA1*0101/DRB5*0101 complexed with a peptide from Epstein Barr Virus DNA polymerase
Classification IMMUNE SYSTEM/TRANSFERASE
Compound HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
Source Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) (DPOL_EBV)
Sequence A:  EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETV
WRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPI
TNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWL
RNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYD
CRVEHWGLDEPLLKHWEFDA
Description (1)  HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN, HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR BETA 1 CHAIN, DNA POLYMERASE (E.C.2.7.7.7)


Functional site

1) chain A
residue 78
type
ligand
sequence N
description BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 78 RESIDUES 1185 TO 1185
source : AC1

2) chain A
residue 118
type
ligand
sequence N
description BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 118 RESIDUES 1183 TO 1184
source : AC2

3) chain A
residue 166
type
ligand
sequence E
description BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 118 RESIDUES 1183 TO 1184
source : AC2

4) chain A
residue 168
type
ligand
sequence W
description BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 118 RESIDUES 1183 TO 1184
source : AC2

5) chain A
residue 78
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1h15_A_1185

6) chain A
residue 118
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1h15_A_1183

7) chain A
residue 166-168
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence EHW
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1h15_A_1183

8) chain A
residue 168
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1h15_A_1184


Display surface

Download
Links