eF-site ID 1h0o-A PDB Code 1h0o Chain A click to enlarge Title Cobalt substitution of mouse R2 ribonucleotide reductase to model the reactive diferrous state Classification OXIDOREDUCTASE Compound RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE Source Mus musculus (Mouse) (RIR2_MOUSE) Sequence A:  NPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWT AEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNE NLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTY IKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGE RVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELIS RDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRIEQEF LTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRV ENPFDFME Description Functional site 1) chain A residue 166 type sequence Q description BINDING SITE FOR RESIDUE CO A1353 source : AC1 2) chain A residue 170 type sequence E description BINDING SITE FOR RESIDUE CO A1353 source : AC1 3) chain A residue 233 type sequence E description BINDING SITE FOR RESIDUE CO A1353 source : AC1 4) chain A residue 267 type sequence E description BINDING SITE FOR RESIDUE CO A1353 source : AC1 5) chain A residue 270 type sequence H description BINDING SITE FOR RESIDUE CO A1353 source : AC1 6) chain A residue 139 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 7) chain A residue 170 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 8) chain A residue 173 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 9) chain A residue 233 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 10) chain A residue 267 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 11) chain A residue 270 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 12) chain A residue 177 type ACT_SITE sequence Y description ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU10014 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 169-185 type prosite sequence MENIHSEMYSLLIDTYI description RIBORED_SMALL Ribonucleotide reductase small subunit signature. MEn.IHSeMYslLidtYI source prosite : PS00368

Display surface Download Links