eF-site ID 1guj-ABCD
PDB Code 1guj
Chain A, B, C, D

click to enlarge
Title Insulin at pH 2: structural analysis of the conditions promoting insulin fibre formation.
Classification HORMONE
Compound INSULIN
Source (INS_HUMAN)
Sequence A:  GIVEQCCTSICSLYQLENYCN
B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
C:  GIVEQCCTSICSLYQLENYCN
D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  INSULIN


Functional site

1) chain A
residue 1
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A1022
source : AC1

2) chain A
residue 2
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SO4 A1022
source : AC1

3) chain A
residue 3
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SO4 A1022
source : AC1

4) chain A
residue 4
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A1022
source : AC1

5) chain D
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A1022
source : AC1

6) chain B
residue 1
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 D1031
source : AC2

7) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 D1031
source : AC2

8) chain D
residue 13
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 D1031
source : AC2


Display surface

Download
Links