eF-site ID 1guj-ABCD PDB Code 1guj Chain A, B, C, D click to enlarge Title Insulin at pH 2: structural analysis of the conditions promoting insulin fibre formation. Classification HORMONE Compound INSULIN Source (INS_HUMAN) Sequence A:  GIVEQCCTSICSLYQLENYCN B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT C:  GIVEQCCTSICSLYQLENYCN D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description Functional site 1) chain A residue 1 type sequence G description BINDING SITE FOR RESIDUE SO4 A1022 source : AC1 2) chain A residue 2 type sequence I description BINDING SITE FOR RESIDUE SO4 A1022 source : AC1 3) chain A residue 3 type sequence V description BINDING SITE FOR RESIDUE SO4 A1022 source : AC1 4) chain A residue 4 type sequence E description BINDING SITE FOR RESIDUE SO4 A1022 source : AC1 5) chain D residue 27 type sequence T description BINDING SITE FOR RESIDUE SO4 A1022 source : AC1 6) chain B residue 1 type sequence F description BINDING SITE FOR RESIDUE SO4 D1031 source : AC2 7) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE SO4 D1031 source : AC2 8) chain D residue 13 type sequence E description BINDING SITE FOR RESIDUE SO4 D1031 source : AC2 9) chain A residue 6-20 type prosite sequence CCTSICSLYQLENYC description INSULIN Insulin family signature. CCTSiCSlyqLenyC source prosite : PS00262

Display surface Download Links