eF-site ID 1gsf-D
PDB Code 1gsf
Chain D

click to enlarge
Title GLUTATHIONE TRANSFERASE A1-1 COMPLEXED WITH ETHACRYNIC ACID
Classification TRANSFERASE (GLUTATHIONE)
Compound GLUTATHIONE TRANSFERASE A1-1
Source Homo sapiens (Human) (GSTA1_HUMAN)
Sequence D:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
Description (1)  GLUTATHIONE TRANSFERASE A1-1, ETHACRYNIC ACID


Functional site

1) chain D
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

2) chain D
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

3) chain D
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

4) chain D
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

5) chain D
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

6) chain D
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

7) chain D
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

8) chain D
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

9) chain D
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

10) chain D
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI4

11) chain D
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI4

12) chain D
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA4


Display surface

Download
Links