eF-site ID 1gsf-D PDB Code 1gsf Chain D click to enlarge Title GLUTATHIONE TRANSFERASE A1-1 COMPLEXED WITH ETHACRYNIC ACID Classification TRANSFERASE (GLUTATHIONE) Compound GLUTATHIONE TRANSFERASE A1-1 Source Homo sapiens (Human) (GSTA1_HUMAN) Sequence D:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG SPRKPPMDEKSLEEARKIFRF Description (1)  GLUTATHIONE TRANSFERASE A1-1, ETHACRYNIC ACID Functional site 1) chain D residue 9 type ligand sequence Y description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 2) chain D residue 10 type ligand sequence F description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 3) chain D residue 14 type ligand sequence G description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 4) chain D residue 15 type ligand sequence R description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 5) chain D residue 55 type ligand sequence V description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 6) chain D residue 107 type ligand sequence L description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 7) chain D residue 111 type ligand sequence V description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 8) chain D residue 208 type ligand sequence M description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 9) chain D residue 220 type ligand sequence F description BINDING SITE FOR RESIDUE EAA D 223 source : AC4 10) chain D residue 8 type BINDING ligand sequence H description Glutathione. source Swiss-Prot : SWS_FT_FI4 11) chain D residue 44 type BINDING ligand sequence L description Glutathione. source Swiss-Prot : SWS_FT_FI4 12) chain D residue 9-10 type binding ligand EAA: ETHACRYNIC ACID sequence YF description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 13) chain D residue 12 type binding ligand EAA: ETHACRYNIC ACID sequence A description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 14) chain D residue 14-15 type binding ligand EAA: ETHACRYNIC ACID sequence GR description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 15) chain D residue 54-56 type binding ligand EAA: ETHACRYNIC ACID sequence QVP description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 16) chain D residue 107-108 type binding ligand EAA: ETHACRYNIC ACID sequence LL description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 17) chain D residue 110-111 type binding ligand EAA: ETHACRYNIC ACID sequence PV description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 18) chain D residue 208 type binding ligand EAA: ETHACRYNIC ACID sequence M description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 19) chain D residue 213 type binding ligand EAA: ETHACRYNIC ACID sequence L description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 20) chain D residue 216 type binding ligand EAA: ETHACRYNIC ACID sequence A description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 21) chain D residue 220 type binding ligand EAA: ETHACRYNIC ACID sequence F description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 22) chain D residue 222 type binding ligand EAA: ETHACRYNIC ACID sequence F description ETHACRYNIC ACID binding site source pdb_hetatom : EAA_1gsf_D_223 23) chain D residue 9 type catalytic ligand sequence Y description Annotated By Reference To The Literature 1oe8 source CSA : CSA4

Display surface Download Links