eF-site ID 1gsf-C
PDB Code 1gsf
Chain C

click to enlarge
Title GLUTATHIONE TRANSFERASE A1-1 COMPLEXED WITH ETHACRYNIC ACID
Classification TRANSFERASE (GLUTATHIONE)
Compound GLUTATHIONE TRANSFERASE A1-1
Source Homo sapiens (Human) (GSTA1_HUMAN)
Sequence C:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
Description (1)  GLUTATHIONE TRANSFERASE A1-1, ETHACRYNIC ACID


Functional site

1) chain C
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

2) chain C
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

3) chain C
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

4) chain C
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

5) chain C
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

6) chain C
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

7) chain C
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

8) chain C
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

9) chain C
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

10) chain C
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI3

11) chain C
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI3

12) chain C
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA3


Display surface

Download
Links