eF-site ID 1gsf-B
PDB Code 1gsf
Chain B

click to enlarge
Title GLUTATHIONE TRANSFERASE A1-1 COMPLEXED WITH ETHACRYNIC ACID
Classification TRANSFERASE (GLUTATHIONE)
Compound GLUTATHIONE TRANSFERASE A1-1
Source Homo sapiens (Human) (GSTA1_HUMAN)
Sequence B:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
Description (1)  GLUTATHIONE TRANSFERASE A1-1, ETHACRYNIC ACID


Functional site

1) chain B
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

2) chain B
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

3) chain B
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

4) chain B
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

5) chain B
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

6) chain B
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

7) chain B
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

8) chain B
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

9) chain B
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

10) chain B
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI2

11) chain B
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI2

12) chain B
residue 9-10
type binding
ligand EAA: ETHACRYNIC ACID
sequence YF
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

13) chain B
residue 12
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

14) chain B
residue 14-15
type binding
ligand EAA: ETHACRYNIC ACID
sequence GR
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

15) chain B
residue 54-56
type binding
ligand EAA: ETHACRYNIC ACID
sequence QVP
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

16) chain B
residue 107-108
type binding
ligand EAA: ETHACRYNIC ACID
sequence LL
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

17) chain B
residue 110-111
type binding
ligand EAA: ETHACRYNIC ACID
sequence PV
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

18) chain B
residue 208
type binding
ligand EAA: ETHACRYNIC ACID
sequence M
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

19) chain B
residue 213
type binding
ligand EAA: ETHACRYNIC ACID
sequence L
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

20) chain B
residue 216
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

21) chain B
residue 220
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

22) chain B
residue 222
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

23) chain B
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA2


Display surface

Download
Links