eF-site ID 1gsf-ABCD
PDB Code 1gsf
Chain A, B, C, D

click to enlarge
Title GLUTATHIONE TRANSFERASE A1-1 COMPLEXED WITH ETHACRYNIC ACID
Classification TRANSFERASE (GLUTATHIONE)
Compound GLUTATHIONE TRANSFERASE A1-1
Source Homo sapiens (Human) (GSTA1_HUMAN)
Sequence A:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
B:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
C:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
D:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
Description (1)  GLUTATHIONE TRANSFERASE A1-1, ETHACRYNIC ACID


Functional site

1) chain A
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

2) chain A
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

3) chain A
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

4) chain A
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

5) chain A
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

6) chain A
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

7) chain A
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

8) chain A
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

9) chain A
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

10) chain B
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

11) chain B
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

12) chain B
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

13) chain B
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

14) chain B
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

15) chain B
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

16) chain B
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

17) chain B
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

18) chain B
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA B 223
source : AC2

19) chain C
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

20) chain C
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

21) chain C
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

22) chain C
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

23) chain C
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

24) chain C
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

25) chain C
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

26) chain C
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

27) chain C
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA C 223
source : AC3

28) chain D
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

29) chain D
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

30) chain D
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

31) chain D
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

32) chain D
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

33) chain D
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

34) chain D
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

35) chain D
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

36) chain D
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA D 223
source : AC4

37) chain A
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI1

38) chain A
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI1

39) chain B
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI2

40) chain B
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI2

41) chain C
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI3

42) chain C
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI3

43) chain D
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI4

44) chain D
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI4

45) chain A
residue 9-10
type binding
ligand EAA: ETHACRYNIC ACID
sequence YF
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

46) chain A
residue 12
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

47) chain A
residue 14-15
type binding
ligand EAA: ETHACRYNIC ACID
sequence GR
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

48) chain A
residue 54-56
type binding
ligand EAA: ETHACRYNIC ACID
sequence QVP
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

49) chain A
residue 107-108
type binding
ligand EAA: ETHACRYNIC ACID
sequence LL
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

50) chain A
residue 110-111
type binding
ligand EAA: ETHACRYNIC ACID
sequence PV
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

51) chain A
residue 208
type binding
ligand EAA: ETHACRYNIC ACID
sequence M
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

52) chain A
residue 213
type binding
ligand EAA: ETHACRYNIC ACID
sequence L
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

53) chain A
residue 216
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

54) chain A
residue 220
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

55) chain A
residue 222
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

56) chain B
residue 9-10
type binding
ligand EAA: ETHACRYNIC ACID
sequence YF
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

57) chain B
residue 12
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

58) chain B
residue 14-15
type binding
ligand EAA: ETHACRYNIC ACID
sequence GR
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

59) chain B
residue 54-56
type binding
ligand EAA: ETHACRYNIC ACID
sequence QVP
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

60) chain B
residue 107-108
type binding
ligand EAA: ETHACRYNIC ACID
sequence LL
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

61) chain B
residue 110-111
type binding
ligand EAA: ETHACRYNIC ACID
sequence PV
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

62) chain B
residue 208
type binding
ligand EAA: ETHACRYNIC ACID
sequence M
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

63) chain B
residue 213
type binding
ligand EAA: ETHACRYNIC ACID
sequence L
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

64) chain B
residue 216
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

65) chain B
residue 220
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

66) chain B
residue 222
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_B_223

67) chain C
residue 9-10
type binding
ligand EAA: ETHACRYNIC ACID
sequence YF
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

68) chain C
residue 12
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

69) chain C
residue 14-15
type binding
ligand EAA: ETHACRYNIC ACID
sequence GR
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

70) chain C
residue 54-56
type binding
ligand EAA: ETHACRYNIC ACID
sequence QVP
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

71) chain C
residue 107-108
type binding
ligand EAA: ETHACRYNIC ACID
sequence LL
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

72) chain C
residue 110-111
type binding
ligand EAA: ETHACRYNIC ACID
sequence PV
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

73) chain C
residue 208
type binding
ligand EAA: ETHACRYNIC ACID
sequence M
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

74) chain C
residue 213
type binding
ligand EAA: ETHACRYNIC ACID
sequence L
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

75) chain C
residue 216
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

76) chain C
residue 220
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

77) chain C
residue 222
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_C_223

78) chain D
residue 9-10
type binding
ligand EAA: ETHACRYNIC ACID
sequence YF
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

79) chain D
residue 12
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

80) chain D
residue 14-15
type binding
ligand EAA: ETHACRYNIC ACID
sequence GR
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

81) chain D
residue 54-56
type binding
ligand EAA: ETHACRYNIC ACID
sequence QVP
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

82) chain D
residue 107-108
type binding
ligand EAA: ETHACRYNIC ACID
sequence LL
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

83) chain D
residue 110-111
type binding
ligand EAA: ETHACRYNIC ACID
sequence PV
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

84) chain D
residue 208
type binding
ligand EAA: ETHACRYNIC ACID
sequence M
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

85) chain D
residue 213
type binding
ligand EAA: ETHACRYNIC ACID
sequence L
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

86) chain D
residue 216
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

87) chain D
residue 220
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

88) chain D
residue 222
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_D_223

89) chain A
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA1

90) chain B
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA2

91) chain C
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA3

92) chain D
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA4


Display surface

Download
Links