eF-site ID 1gsf-A
PDB Code 1gsf
Chain A

click to enlarge
Title GLUTATHIONE TRANSFERASE A1-1 COMPLEXED WITH ETHACRYNIC ACID
Classification TRANSFERASE (GLUTATHIONE)
Compound GLUTATHIONE TRANSFERASE A1-1
Source Homo sapiens (Human) (GSTA1_HUMAN)
Sequence A:  AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDL
DKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNL
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG
SPRKPPMDEKSLEEARKIFRF
Description (1)  GLUTATHIONE TRANSFERASE A1-1, ETHACRYNIC ACID


Functional site

1) chain A
residue 9
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

2) chain A
residue 10
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

3) chain A
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

4) chain A
residue 15
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

5) chain A
residue 55
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

6) chain A
residue 107
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

7) chain A
residue 111
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

8) chain A
residue 208
type
ligand
sequence M
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

9) chain A
residue 220
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EAA A 223
source : AC1

10) chain A
residue 8
type BINDING
ligand
sequence H
description Glutathione.
source Swiss-Prot : SWS_FT_FI1

11) chain A
residue 44
type BINDING
ligand
sequence L
description Glutathione.
source Swiss-Prot : SWS_FT_FI1

12) chain A
residue 9-10
type binding
ligand EAA: ETHACRYNIC ACID
sequence YF
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

13) chain A
residue 12
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

14) chain A
residue 14-15
type binding
ligand EAA: ETHACRYNIC ACID
sequence GR
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

15) chain A
residue 54-56
type binding
ligand EAA: ETHACRYNIC ACID
sequence QVP
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

16) chain A
residue 107-108
type binding
ligand EAA: ETHACRYNIC ACID
sequence LL
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

17) chain A
residue 110-111
type binding
ligand EAA: ETHACRYNIC ACID
sequence PV
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

18) chain A
residue 208
type binding
ligand EAA: ETHACRYNIC ACID
sequence M
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

19) chain A
residue 213
type binding
ligand EAA: ETHACRYNIC ACID
sequence L
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

20) chain A
residue 216
type binding
ligand EAA: ETHACRYNIC ACID
sequence A
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

21) chain A
residue 220
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

22) chain A
residue 222
type binding
ligand EAA: ETHACRYNIC ACID
sequence F
description ETHACRYNIC ACID binding site
source pdb_hetatom : EAA_1gsf_A_223

23) chain A
residue 9
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA1


Display surface

Download
Links