eF-site ID 1gnw-A PDB Code 1gnw Chain A click to enlarge Title STRUCTURE OF GLUTATHIONE S-TRANSFERASE Classification TRANSFERASE Compound GLUTATHIONE S-TRANSFERASE Source Arabidopsis thaliana (Mouse-ear cress) (GSTF4_ARATH) Sequence A:  GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHK KEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQ GTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQ IFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLA GETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEI TKRPASEKVQ Description Functional site 1) chain A residue 35 type sequence L description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 2) chain A residue 40 type sequence H description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 3) chain A residue 41 type sequence K description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 4) chain A residue 53 type sequence Q description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 5) chain A residue 54 type sequence V description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 6) chain A residue 55 type sequence P description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 7) chain A residue 66 type sequence E description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 8) chain A residue 67 type sequence S description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 9) chain A residue 68 type sequence R description BINDING SITE FOR RESIDUE GTX A 212 source : AC1 10) chain A residue 11 type sequence S description BINDING SITE FOR RESIDUE GTX A 213 source : AC2 11) chain A residue 12 type sequence I description BINDING SITE FOR RESIDUE GTX A 213 source : AC2 12) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE GTX A 213 source : AC2 13) chain A residue 53 type sequence Q description BINDING SITE FOR RESIDUE GTX A 213 source : AC2 14) chain A residue 108 type sequence H description BINDING SITE FOR RESIDUE GTX B 212 source : AC3 15) chain A residue 12 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 41 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 54 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 67 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links