eF-site ID 1gi6-A PDB Code 1gi6 Chain A click to enlarge Title A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE Classification HYDROLASE Compound BETA-TRYPSIN Source ORGANISM_COMMON: cattle; ORGANISM_SCIENTIFIC: Bos taurus; Sequence A:  IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAH CYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG WGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQK NKPGVYTKVCNYVSWIKQTIASN Description Functional site 1) chain A residue 70 type sequence E description BINDING SITE FOR RESIDUE CA A 247 source : AC1 2) chain A residue 72 type sequence N description BINDING SITE FOR RESIDUE CA A 247 source : AC1 3) chain A residue 75 type sequence V description BINDING SITE FOR RESIDUE CA A 247 source : AC1 4) chain A residue 80 type sequence E description BINDING SITE FOR RESIDUE CA A 247 source : AC1 5) chain A residue 174 type sequence G description BINDING SITE FOR RESIDUE CL A 260 source : AC2 6) chain A residue 240 type sequence Q description BINDING SITE FOR RESIDUE CL A 260 source : AC2 7) chain A residue 91 type sequence H description BINDING SITE FOR RESIDUE SO4 A 467 source : AC3 8) chain A residue 234 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 467 source : AC3 9) chain A residue 237 type sequence W description BINDING SITE FOR RESIDUE SO4 A 467 source : AC3 10) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 11) chain A residue 189 type sequence D description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 12) chain A residue 190 type sequence S description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 13) chain A residue 192 type sequence Q description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 14) chain A residue 195 type sequence S description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 15) chain A residue 213 type sequence V description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 16) chain A residue 219 type sequence G description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 17) chain A residue 226 type sequence G description BINDING SITE FOR RESIDUE 124 A 246 source : AC4 18) chain A residue 53-58 type prosite sequence VSAAHC description TRYPSIN_HIS Serine proteases, trypsin family, histidine active site. VSAAHC source prosite : PS00134 19) chain A residue 189-200 type prosite sequence DSCQGDSGGPVV description TRYPSIN_SER Serine proteases, trypsin family, serine active site. DScqGDSGGPVV source prosite : PS00135 20) chain A residue 60 type ACT_SITE sequence K description Charge relay system source Swiss-Prot : SWS_FT_FI1 21) chain A residue 105 type ACT_SITE sequence L description Charge relay system source Swiss-Prot : SWS_FT_FI1 22) chain A residue 198 type ACT_SITE sequence P description Charge relay system source Swiss-Prot : SWS_FT_FI1 23) chain A residue 73 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 75 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 78 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 83 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2 27) chain A residue 192 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI2 28) chain A residue 195 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI2 29) chain A residue 198 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links