eF-site ID 1ghe-AB PDB Code 1ghe Chain A, B click to enlarge Title CRYSTAL STRUCTURE OF TABTOXIN RESISTANCE PROTEIN COMPLEXED WITH AN ACYL COENZYME A Classification TRANSFERASE Compound ACETYLTRANSFERASE Source Pseudomonas amygdali pv. tabaci (Pseudomonas syringae pv. tabaci) (TTR_PSESZ) Sequence A:  AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFXADLDX QQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQ KPNGLNRAEVQKLXVLPSARGRGLGRQLXDEVEQVAVKHK RGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRL HPTAIYFKTL B:  HAQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFXADLD XQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLC QKPNGLNRAEVQKLXVLPSARGRGLGRQLXDEVEQVAVKH KRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGR LHPTAIYFKTL Description Functional site 1) chain A residue 93 type sequence V description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 2) chain A residue 94 type sequence Q description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 3) chain A residue 95 type sequence K description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 4) chain A residue 96 type sequence L description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 5) chain A residue 97 type sequence X description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 6) chain A residue 98 type sequence V description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 7) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 8) chain A residue 104 type sequence G description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 9) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 10) chain A residue 106 type sequence G description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 11) chain A residue 107 type sequence L description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 12) chain A residue 108 type sequence G description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 13) chain A residue 109 type sequence R description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 14) chain A residue 129 type sequence L description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 15) chain A residue 130 type sequence D description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 16) chain A residue 131 type sequence T description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 17) chain A residue 136 type sequence V description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 18) chain A residue 137 type sequence A description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 19) chain A residue 139 type sequence A description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 20) chain A residue 140 type sequence F description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 21) chain A residue 141 type sequence Y description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 22) chain A residue 143 type sequence A description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 23) chain B residue 27 type sequence E description BINDING SITE FOR RESIDUE ACO A 301 source : AC1 24) chain B residue 93 type sequence V description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 25) chain B residue 94 type sequence Q description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 26) chain B residue 96 type sequence L description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 27) chain B residue 97 type sequence X description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 28) chain B residue 98 type sequence V description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 29) chain B residue 103 type sequence R description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 30) chain B residue 104 type sequence G description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 31) chain B residue 105 type sequence R description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 32) chain B residue 106 type sequence G description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 33) chain B residue 107 type sequence L description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 34) chain B residue 108 type sequence G description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 35) chain B residue 109 type sequence R description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 36) chain B residue 130 type sequence D description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 37) chain B residue 131 type sequence T description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 38) chain B residue 136 type sequence V description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 39) chain B residue 137 type sequence A description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 40) chain B residue 138 type sequence E description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 41) chain B residue 139 type sequence A description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 42) chain B residue 140 type sequence F description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 43) chain B residue 141 type sequence Y description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 44) chain B residue 143 type sequence A description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 45) chain B residue 148 type sequence R description BINDING SITE FOR RESIDUE ACO B 302 source : AC2 46) chain A residue 27 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12527305 source Swiss-Prot : SWS_FT_FI1 47) chain A residue 141 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12527305 source Swiss-Prot : SWS_FT_FI1 48) chain B residue 27 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12527305 source Swiss-Prot : SWS_FT_FI1 49) chain B residue 141 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12527305 source Swiss-Prot : SWS_FT_FI1 50) chain A residue 96 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 51) chain A residue 104 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 52) chain A residue 130 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 53) chain B residue 96 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 54) chain B residue 104 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 55) chain B residue 130 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links