eF-site ID 1g9t-A PDB Code 1g9t Chain A click to enlarge Title CRYSTAL STRUCTURE OF E.COLI HPRT-GMP COMPLEX Classification TRANSFERASE Compound HYPOXANTHINE PHOSPHORIBOSYLTRANSFERASE Source Escherichia coli (strain K12) (HPRT_ECOLI) Sequence A:  MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVG LLRGSFMFMADLCREVQVSHEVDFMTASRDLKILKDLDED IRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLL DKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPY IGKVILL Description Functional site 1) chain A residue 103 type sequence E description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 2) chain A residue 105 type sequence I description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 3) chain A residue 107 type sequence D description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 4) chain A residue 108 type sequence S description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 5) chain A residue 109 type sequence G description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 6) chain A residue 110 type sequence N description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 7) chain A residue 111 type sequence T description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 8) chain A residue 112 type sequence L description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 9) chain A residue 135 type sequence K description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 10) chain A residue 156 type sequence F description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 11) chain A residue 157 type sequence V description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 12) chain A residue 162 type sequence I description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 13) chain A residue 163 type sequence D description BINDING SITE FOR RESIDUE 5GP A 190 source : AC1 14) chain A residue 107 type ACT_SITE sequence D description Proton acceptor => ECO:0000305|PubMed:12070315 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 47 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P9WHQ9 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 48 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:P9WHQ9 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 169 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P9WHQ9 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 103 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12070315, ECO:0007744|PDB:1GRV source Swiss-Prot : SWS_FT_FI3 19) chain A residue 104 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12070315, ECO:0007744|PDB:1GRV source Swiss-Prot : SWS_FT_FI3 20) chain A residue 107 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12070315, ECO:0007744|PDB:1G9S source Swiss-Prot : SWS_FT_FI4 21) chain A residue 135 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12070315, ECO:0007744|PDB:1G9S source Swiss-Prot : SWS_FT_FI4 22) chain A residue 163 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12070315, ECO:0007744|PDB:1G9T source Swiss-Prot : SWS_FT_FI5 23) chain A residue 99-111 type prosite sequence VLIVEDIIDSGNT description PUR_PYR_PR_TRANSFER Purine/pyrimidine phosphoribosyl transferases signature. VLIVEDIIDSGnT source prosite : PS00103

Display surface Download Links