eF-site ID 1g7a-B
PDB Code 1g7a
Chain B

click to enlarge
Title 1.2 A structure of T3R3 human insulin at 100 K
Classification hormone/growth factor
Compound INSULIN A-CHAIN
Source Homo sapiens (Human) (INS_HUMAN)
Sequence B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  INSULIN


Functional site

1) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 901
source : AC1

2) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 951
source : AC6

3) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 961
source : AC7

4) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL B 902
source : AC8

5) chain B
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CL D 923
source : BC2


Display surface

Download
Links