eF-site ID 1g7a-ABCDEFGH
PDB Code 1g7a
Chain A, B, C, D, E, F, G, H

click to enlarge
Title 1.2 A structure of T3R3 human insulin at 100 K
Classification hormone/growth factor
Compound INSULIN A-CHAIN
Source Homo sapiens (Human) (INS_HUMAN)
Sequence A:  GIVEQCCTSICSLYQLENYCN
B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
C:  GIVEQCCTSICSLYQLENYCN
D:  FVNQHLCGSHLVEALYLVCGERGFFYTPK
E:  GIVEQCCTSICSLYQLENYCN
F:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
G:  GIVEQCCTSICSLYQLENYCN
H:  VNQHLCGSHLVEALYLVCGERGFFYTPK
Description (1)  INSULIN


Functional site

1) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 901
source : AC1

2) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 911
source : AC2

3) chain D
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 921
source : AC3

4) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 921
source : AC3

5) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN F 931
source : AC4

6) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN H 941
source : AC5

7) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 951
source : AC6

8) chain H
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 951
source : AC6

9) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 961
source : AC7

10) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL B 902
source : AC8

11) chain D
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CL D 912
source : AC9

12) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 912
source : AC9

13) chain D
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 922
source : BC1

14) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 922
source : BC1

15) chain B
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CL D 923
source : BC2

16) chain D
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 923
source : BC2

17) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL D 923
source : BC2

18) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL F 932
source : BC3

19) chain H
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CL H 942
source : BC4

20) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL H 942
source : BC4

21) chain E
residue 1
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL E 1101
source : BC5

22) chain E
residue 2
type
ligand
sequence I
description BINDING SITE FOR RESIDUE CL E 1101
source : BC5

23) chain E
residue 3
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CL E 1101
source : BC5

24) chain E
residue 4
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CL E 1101
source : BC5

25) chain F
residue 29
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL E 1101
source : BC5

26) chain F
residue 30
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL E 1101
source : BC5

27) chain G
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL G 995
source : BC6

28) chain G
residue 16
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL G 995
source : BC6

29) chain H
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL G 995
source : BC6

30) chain F
residue 1
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ACN G 991
source : BC7

31) chain G
residue 13
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ACN G 991
source : BC7

32) chain G
residue 14
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ACN G 991
source : BC7

33) chain D
residue 1
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ACN F 992
source : BC8

34) chain F
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ACN F 992
source : BC8

35) chain F
residue 6
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ACN F 992
source : BC8

36) chain F
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ACN F 992
source : BC8

37) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ACN F 992
source : BC8

38) chain D
residue 1
type binding
ligand ACN: ACETONE
sequence F
description ACETONE binding site
source pdb_hetatom : ACN_1g7a_F_992

39) chain F
residue 4-7
type binding
ligand ACN: ACETONE
sequence QHLC
description ACETONE binding site
source pdb_hetatom : ACN_1g7a_F_992

40) chain F
residue 10-11
type binding
ligand ACN: ACETONE
sequence HL
description ACETONE binding site
source pdb_hetatom : ACN_1g7a_F_992

41) chain G
residue 6-7
type binding
ligand GOL: GLYCEROL
sequence CC
description GLYCEROL binding site
source pdb_hetatom : GOL_1g7a_G_995

42) chain G
residue 10-13
type binding
ligand GOL: GLYCEROL
sequence ICSL
description GLYCEROL binding site
source pdb_hetatom : GOL_1g7a_G_995

43) chain G
residue 16
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_1g7a_G_995

44) chain H
residue 7
type binding
ligand GOL: GLYCEROL
sequence C
description GLYCEROL binding site
source pdb_hetatom : GOL_1g7a_G_995

45) chain H
residue 10-11
type binding
ligand GOL: GLYCEROL
sequence HL
description GLYCEROL binding site
source pdb_hetatom : GOL_1g7a_G_995

46) chain H
residue 14
type binding
ligand GOL: GLYCEROL
sequence A
description GLYCEROL binding site
source pdb_hetatom : GOL_1g7a_G_995

47) chain G
residue 13-14
type binding
ligand ACN: ACETONE
sequence LY
description ACETONE binding site
source pdb_hetatom : ACN_1g7a_G_991

48) chain G
residue 16-18
type binding
ligand ACN: ACETONE
sequence LEN
description ACETONE binding site
source pdb_hetatom : ACN_1g7a_G_991

49) chain H
residue 22
type binding
ligand ACN: ACETONE
sequence R
description ACETONE binding site
source pdb_hetatom : ACN_1g7a_G_991


Display surface

Download
Links