eF-site ID 1g6k-E
PDB Code 1g6k
Chain E

click to enlarge
Title Crystal structure of glucose dehydrogenase mutant E96A complexed with NAD+
Classification OXIDOREDUCTASE
Compound GLUCOSE 1-DEHYDROGENASE
Source Bacillus megaterium (DHG_BACME)
Sequence E:  MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRS
KEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAI
KEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGA
FLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAA
SKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKF
ADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVT
GITLFADGGMTQYPSFQAGRG
Description (1)  GLUCOSE 1-DEHYDROGENASE(E.C.1.1.1.47)


Functional site

1) chain E
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

2) chain E
residue 17
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

3) chain E
residue 18
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

4) chain E
residue 19
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

5) chain E
residue 39
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

6) chain E
residue 64
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

7) chain E
residue 65
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

8) chain E
residue 66
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

9) chain E
residue 92
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

10) chain E
residue 93
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

11) chain E
residue 94
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

12) chain E
residue 115
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

13) chain E
residue 143
type
ligand
sequence M
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

14) chain E
residue 144
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

15) chain E
residue 145
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

16) chain E
residue 158
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

17) chain E
residue 162
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

18) chain E
residue 188
type
ligand
sequence P
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

19) chain E
residue 189
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

20) chain E
residue 191
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

21) chain E
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

22) chain E
residue 195
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

23) chain E
residue 196
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAD E 3262
source : AC3

24) chain E
residue 158
type ACT_SITE
ligand
sequence Y
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI7

25) chain E
residue 145
type BINDING
ligand
sequence S
description Substrate (By similarity).
source Swiss-Prot : SWS_FT_FI8

26) chain E
residue 11-35
type NP_BIND
ligand
sequence VITGSSTGLGKSMAIRFATEKAKVV
description NADP.
source Swiss-Prot : SWS_FT_FI9

27) chain E
residue 145-173
type prosite
ligand
sequence SVHEKIPWPLFVHYAASKGGMKLMTETLA
description Short-chain dehydrogenases/reductases family signature.[LIVSPADNK]-x(9)-{P}-x(2)-Y-[PSTAGNCV]-[STAGNQCIVM]-[STAGC]-K-{PC}-[SAGFYR]-[LIVMSTAGD]-x-{K}-[LIVMFYW]-{D}-x-{YR}-[LIVMFYWGAPTHQ]-[GSACQRHM].
source prosite : PS00061

28) chain E
residue 145
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

29) chain E
residue 158
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

30) chain E
residue 162
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

31) chain E
residue 145
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7

32) chain E
residue 158
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7

33) chain E
residue 116
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7

34) chain E
residue 162
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7

35) chain E
residue 155
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1eq2
source CSA : CSA11

36) chain E
residue 162
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA11

37) chain E
residue 158
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA15

38) chain E
residue 162
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA15


Display surface

Download
Links