eF-site ID 1g65-F
PDB Code 1g65
Chain F

click to enlarge
Title Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors
Classification HYDROLASE/HYDROLASE inhibitor
Compound Proteasome component Y7
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae;
Sequence F:  GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCND
GVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPD
GRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHT
LYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAA
TGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAH
EDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQ
KEIN
Description (1)  PROTEIN (PROTEASOME COMPONENT Y7), PROTEIN (PROTEASOME COMPONENT Y13), PROTEIN (PROTEASOME COMPONENT PRE6), PROTEIN (PROTEASOME COMPONENT PUP2), PROTEIN (PROTEASOME COMPONENT PRE5), PROTEIN (PROTEASOME COMPONENT C1), PROTEIN (PROTEASOME COMPONENT C7-ALPHA), PROTEIN (PROTEASOME COMPONENT PUP1), PROTEIN (PROTEASOME COMPONENT PUP3), PROTEIN (PROTEASOME COMPONENT C11), PROTEIN (PROTEOSOME COMPONENT PRE2), PROTEIN (POTENTIAL PROTEOSOME COMPONENT C5), PROTEIN (PROTEOSOME COMPONENT PRE4), PROTEIN (PROTEASOME COMPONENT PRE3), EPOXOMICIN


Functional site

1) chain F
residue 152
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG F 301
source : AC2

2) chain F
residue 13
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG F 302
source : AC3

3) chain F
residue 127
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MG F 302
source : AC3


Display surface

Download
Links