eF-site ID 1g27-A PDB Code 1g27 Chain A click to enlarge Title CRYSTAL STRUCTURE OF E.COLI POLYPEPTIDE DEFORMYLASE COMPLEXED WITH THE INHIBITOR BB-3497 Classification HYDROLASE Compound POLYPEPTIDE DEFORMYLASE Source null (DEF_ECOLI) Sequence A:  SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYA EEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK SGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFEL EADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK LDRL Description Functional site 1) chain A residue 50 type sequence Q description BINDING SITE FOR RESIDUE NI A 9001 source : AC1 2) chain A residue 90 type sequence C description BINDING SITE FOR RESIDUE NI A 9001 source : AC1 3) chain A residue 132 type sequence H description BINDING SITE FOR RESIDUE NI A 9001 source : AC1 4) chain A residue 136 type sequence H description BINDING SITE FOR RESIDUE NI A 9001 source : AC1 5) chain A residue 43 type sequence G description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 6) chain A residue 44 type sequence I description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 7) chain A residue 45 type sequence G description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 8) chain A residue 50 type sequence Q description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 9) chain A residue 89 type sequence G description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 10) chain A residue 90 type sequence C description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 11) chain A residue 91 type sequence L description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 12) chain A residue 132 type sequence H description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 13) chain A residue 133 type sequence E description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 14) chain A residue 136 type sequence H description BINDING SITE FOR RESIDUE BB1 A 1001 source : AC4 15) chain A residue 46 type catalytic sequence L description 98 source MCSA : MCSA1 16) chain A residue 51 type catalytic sequence V description 98 source MCSA : MCSA1 17) chain A residue 91 type catalytic sequence L description 98 source MCSA : MCSA1 18) chain A residue 92 type catalytic sequence S description 98 source MCSA : MCSA1 19) chain A residue 133 type catalytic sequence E description 98 source MCSA : MCSA1 20) chain A residue 134 type catalytic sequence M description 98 source MCSA : MCSA1 21) chain A residue 137 type catalytic sequence L description 98 source MCSA : MCSA1 22) chain A residue 134 type ACT_SITE sequence M description ACT_SITE => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 91 type BINDING sequence L description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 133 type BINDING sequence E description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 137 type BINDING sequence L description BINDING => ECO:0000269|PubMed:9846875 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links