eF-site ID 1g17-B
PDB Code 1g17
Chain B

click to enlarge
Title CRYSTAL STRUCTURE OF SEC4-GUANOSINE-5'-(BETA,GAMMA)-IMIDOTRIPHOSPHATE
Classification SIGNALING PROTEIN,ENDOCYTOSIS/EXOCYTOSIS
Compound RAS-RELATED PROTEIN SEC4
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (SEC4_YEAST)
Sequence B:  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFK
IKTVDINGKKVKLQIWDTAGQERFRTITTAYYRGAMGIIL
VYDITDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME
TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAK
LIQEKIDS
Description (1)  RAS-RELATED PROTEIN SEC4


Functional site

1) chain B
residue 34
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG B 302
source : AC2

2) chain B
residue 52
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG B 302
source : AC2

3) chain B
residue 29
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

4) chain B
residue 30
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

5) chain B
residue 31
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

6) chain B
residue 32
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

7) chain B
residue 33
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

8) chain B
residue 34
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

9) chain B
residue 35
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

10) chain B
residue 45
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

11) chain B
residue 46
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

12) chain B
residue 47
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

13) chain B
residue 48
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

14) chain B
residue 49
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

15) chain B
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

16) chain B
residue 52
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

17) chain B
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

18) chain B
residue 133
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

19) chain B
residue 134
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

20) chain B
residue 136
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

21) chain B
residue 137
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

22) chain B
residue 162
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

23) chain B
residue 163
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

24) chain B
residue 164
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

25) chain B
residue 58-62
type NP_BIND
ligand
sequence KIKTV
description GTP.
source Swiss-Prot : SWS_FT_FI3

26) chain B
residue 116-119
type NP_BIND
ligand
sequence KTVN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI4

27) chain B
residue 23-36
type prosite
ligand
sequence ILLIGDSGVGKSCL
description Sigma-54 interaction domain ATP-binding region A signature. [LIVMFY](3)-x-G-[DEQ]-[STE]-G-[STAV]-G-K-x(2)-[LIVMFY]
source prosite : PS00675

28) chain B
residue 27-35
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence GDSGVGKSC
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

29) chain B
residue 45-52
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence FNPSFITT
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

30) chain B
residue 75-79
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence DTAGQ
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

31) chain B
residue 133-134
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence NK
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

32) chain B
residue 136-137
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence DM
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

33) chain B
residue 161-164
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence SSAK
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

34) chain B
residue 79
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ksj
source CSA : CSA2

35) chain B
residue 30
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1ksj
source CSA : CSA4


Display surface

Download
Links