eF-site ID 1g17-AB
PDB Code 1g17
Chain A, B

click to enlarge
Title CRYSTAL STRUCTURE OF SEC4-GUANOSINE-5'-(BETA,GAMMA)-IMIDOTRIPHOSPHATE
Classification SIGNALING PROTEIN,ENDOCYTOSIS/EXOCYTOSIS
Compound RAS-RELATED PROTEIN SEC4
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (SEC4_YEAST)
Sequence A:  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFK
IKTVDINGKKVKLQIWDTAGQERFRTITTAYYRGAMGIIL
VYDITDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME
TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAK
LIQEKIDS
B:  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFK
IKTVDINGKKVKLQIWDTAGQERFRTITTAYYRGAMGIIL
VYDITDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME
TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAK
LIQEKIDS
Description (1)  RAS-RELATED PROTEIN SEC4


Functional site

1) chain A
residue 34
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG A 301
source : AC1

2) chain A
residue 52
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG A 301
source : AC1

3) chain B
residue 34
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MG B 302
source : AC2

4) chain B
residue 52
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG B 302
source : AC2

5) chain A
residue 29
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

6) chain A
residue 30
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

7) chain A
residue 31
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

8) chain A
residue 32
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

9) chain A
residue 33
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

10) chain A
residue 34
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

11) chain A
residue 35
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

12) chain A
residue 45
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

13) chain A
residue 46
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

14) chain A
residue 47
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

15) chain A
residue 48
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

16) chain A
residue 49
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

17) chain A
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

18) chain A
residue 52
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

19) chain A
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

20) chain A
residue 133
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

21) chain A
residue 134
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

22) chain A
residue 136
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

23) chain A
residue 137
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

24) chain A
residue 162
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

25) chain A
residue 163
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

26) chain A
residue 164
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP A 201
source : AC3

27) chain B
residue 29
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

28) chain B
residue 30
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

29) chain B
residue 31
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

30) chain B
residue 32
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

31) chain B
residue 33
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

32) chain B
residue 34
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

33) chain B
residue 35
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

34) chain B
residue 45
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

35) chain B
residue 46
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

36) chain B
residue 47
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

37) chain B
residue 48
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

38) chain B
residue 49
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

39) chain B
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

40) chain B
residue 52
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

41) chain B
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

42) chain B
residue 133
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

43) chain B
residue 134
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

44) chain B
residue 136
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

45) chain B
residue 137
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

46) chain B
residue 162
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

47) chain B
residue 163
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

48) chain B
residue 164
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GNP B 202
source : AC4

49) chain A
residue 58-62
type NP_BIND
ligand
sequence KIKTV
description GTP.
source Swiss-Prot : SWS_FT_FI1

50) chain A
residue 116-119
type NP_BIND
ligand
sequence KTVN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI2

51) chain B
residue 58-62
type NP_BIND
ligand
sequence KIKTV
description GTP.
source Swiss-Prot : SWS_FT_FI3

52) chain B
residue 116-119
type NP_BIND
ligand
sequence KTVN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI4

53) chain A
residue 23-36
type prosite
ligand
sequence ILLIGDSGVGKSCL
description Sigma-54 interaction domain ATP-binding region A signature. [LIVMFY](3)-x-G-[DEQ]-[STE]-G-[STAV]-G-K-x(2)-[LIVMFY]
source prosite : PS00675

54) chain B
residue 23-36
type prosite
ligand
sequence ILLIGDSGVGKSCL
description Sigma-54 interaction domain ATP-binding region A signature. [LIVMFY](3)-x-G-[DEQ]-[STE]-G-[STAV]-G-K-x(2)-[LIVMFY]
source prosite : PS00675

55) chain A
residue 27-35
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence GDSGVGKSC
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_A_201

56) chain A
residue 45-52
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence FNPSFITT
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_A_201

57) chain A
residue 75-79
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence DTAGQ
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_A_201

58) chain A
residue 133-134
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence NK
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_A_201

59) chain A
residue 136-137
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence DM
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_A_201

60) chain A
residue 161-164
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence SSAK
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_A_201

61) chain B
residue 27-35
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence GDSGVGKSC
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

62) chain B
residue 45-52
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence FNPSFITT
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

63) chain B
residue 75-79
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence DTAGQ
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

64) chain B
residue 133-134
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence NK
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

65) chain B
residue 136-137
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence DM
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

66) chain B
residue 161-164
type binding
ligand GNP: PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
sequence SSAK
description PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER binding site
source pdb_hetatom : GNP_1g17_B_202

67) chain A
residue 79
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ksj
source CSA : CSA1

68) chain B
residue 79
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ksj
source CSA : CSA2

69) chain A
residue 30
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1ksj
source CSA : CSA3

70) chain B
residue 30
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1ksj
source CSA : CSA4


Display surface

Download
Links