eF-site ID 1g16-A PDB Code 1g16 Chain A click to enlarge Title CRYSTAL STRUCTURE OF SEC4-GDP Classification SIGNALING PROTEIN,ENDOCYTOSIS/EXOCYTOSIS Compound RAS-RELATED PROTEIN SEC4 Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (SEC4_YEAST) Sequence A:  SIXKILLIGDSGVGKSCLLVRFVEDKFNPIDFKIKTVDIN GKKVKLQIWDTAGQERFRTITTAYYRGAXGIILVYDITDE RTFTNIKQWFKTVNEHANDEAQLLLVGNKSDXETRVVTAD QGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKI Description (1)  RAS-RELATED PROTEIN SEC4 Functional site 1) chain A residue 34 type sequence S description BINDING SITE FOR RESIDUE CO A 301 source : AC1 2) chain A residue 43 type sequence D description BINDING SITE FOR RESIDUE CO A 305 source : AC5 3) chain A residue 166 type sequence D description BINDING SITE FOR RESIDUE CO A 305 source : AC5 4) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE CO C 306 source : AC6 5) chain A residue 29 type sequence S description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 6) chain A residue 30 type sequence G description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 7) chain A residue 31 type sequence V description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 8) chain A residue 32 type sequence G description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 9) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 10) chain A residue 34 type sequence S description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 11) chain A residue 35 type sequence C description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 12) chain A residue 45 type sequence F description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 13) chain A residue 47 type sequence P description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 14) chain A residue 133 type sequence N description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 15) chain A residue 134 type sequence K description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 16) chain A residue 136 type sequence D description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 17) chain A residue 137 type sequence X description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 18) chain A residue 162 type sequence S description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 19) chain A residue 163 type sequence A description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 20) chain A residue 164 type sequence K description BINDING SITE FOR RESIDUE GDP A 201 source : AC9 21) chain A residue 27 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 22) chain A residue 75 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 23) chain A residue 133 type BINDING sequence N description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 23-36 type prosite sequence ILLIGDSGVGKSCL description SIGMA54_INTERACT_1 Sigma-54 interaction domain ATP-binding region A signature. ILLiGDSGVGKscL source prosite : PS00675

Display surface Download Links