eF-site ID 1fvv-D
PDB Code 1fvv
Chain D

click to enlarge
Title THE STRUCTURE OF CDK2/CYCLIN A IN COMPLEX WITH AN OXINDOLE INHIBITOR
Classification TRANSFERASE, CELL CYCLE
Compound CYCLIN-DEPENDENT KINASE 2
Source Homo sapiens (Human) (CCNA2_HUMAN)
Sequence D:  NEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRA
ILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGK
LQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVL
RMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESL
AMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSW
PESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREK
YKNSKYHGVSLLNPPETLNL
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37)/CYCLIN A


Functional site

1) chain D
residue 211-242
type prosite
ligand
sequence RAILVDWLVEVGEEYKLQNETLHLAVNYIDRF
description Cyclins signature. R-x(2)-[LIVMSA]-x(2)-[FYWS]-[LIVM]-x(8)-[LIVMFC]-x(4)-[LIVMFYA]-x(2)
source prosite : PS00292


Display surface

Download
Links