eF-site ID 1fvg-A PDB Code 1fvg Chain A click to enlarge Title CRYSTAL STRUCTURE OF BOVINE PEPTIDE METHIONINE SULFOXIDE REDUCTASE Classification OXIDOREDUCTASE Compound PEPTIDE METHIONINE SULFOXIDE REDUCTASE Source (MSRA_BOVIN) Sequence A:  KIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFPEGTQXA VFGXGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEV CSGKTGHAEVVRVVFQPEHISFEELLKVFWENHDPTQGXR QGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKVLSEHGF GLITTDIREGQTFYYAEDYHQQYLSKDPDGYC Description (1)  PEPTIDE METHIONINE SULFOXIDE REDUCTASE (E.C.1.8.4.5) Functional site 1) chain A residue 72 type sequence C description BINDING SITE FOR RESIDUE DTT A 300 source : AC1 2) chain A residue 103 type sequence Y description BINDING SITE FOR RESIDUE DTT A 300 source : AC1 3) chain A residue 115 type sequence E description BINDING SITE FOR RESIDUE DTT A 300 source : AC1 4) chain A residue 150 type sequence D description BINDING SITE FOR RESIDUE DTT A 300 source : AC1 5) chain A residue 155 type sequence Y description BINDING SITE FOR RESIDUE DTT A 300 source : AC1 6) chain A residue 218 type sequence C description BINDING SITE FOR RESIDUE DTT A 300 source : AC1 7) chain A residue 72 type catalytic sequence C description 122 source MCSA : MCSA1 8) chain A residue 103 type catalytic sequence Y description 122 source MCSA : MCSA1 9) chain A residue 115 type catalytic sequence E description 122 source MCSA : MCSA1 10) chain A residue 150 type catalytic sequence D description 122 source MCSA : MCSA1 11) chain A residue 155 type catalytic sequence Y description 122 source MCSA : MCSA1 12) chain A residue 218 type catalytic sequence C description 122 source MCSA : MCSA1 13) chain A residue 72 type ACT_SITE sequence C description Cysteine sulfenic acid (-SOH) intermediate => ECO:0000250|UniProtKB:P0A744 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 104 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:Q9D6Y7 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links