eF-site ID 1fv9-A PDB Code 1fv9 Chain A click to enlarge Title Crystal structure of human microurokinase in complex with 2-amino-5-hydroxy-benzimidazole Classification BLOOD CLOTTING Compound UROKINASE Source Homo sapiens (Human) (UROK_HUMAN) Sequence A:  IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCW VISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTI ALPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW IRSHT Description (1)  UROKINASE (E.C.3.4.21.73) Functional site 1) chain A residue 45 type sequence H description BINDING SITE FOR RESIDUE SO4 A 245 source : AC1 2) chain A residue 194 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 245 source : AC1 3) chain A residue 195 type sequence G description BINDING SITE FOR RESIDUE SO4 A 245 source : AC1 4) chain A residue 197 type sequence S description BINDING SITE FOR RESIDUE SO4 A 245 source : AC1 5) chain A residue 191 type sequence D description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 6) chain A residue 192 type sequence S description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 7) chain A residue 193 type sequence C description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 8) chain A residue 194 type sequence Q description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 9) chain A residue 215 type sequence V description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 10) chain A residue 218 type sequence G description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 11) chain A residue 220 type sequence G description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 12) chain A residue 228 type sequence G description BINDING SITE FOR RESIDUE 172 A 246 source : AC2 13) chain A residue 41-46 type prosite sequence ISATHC description TRYPSIN_HIS Serine proteases, trypsin family, histidine active site. ISATHC source prosite : PS00134 14) chain A residue 191-202 type prosite sequence DSCQGDSGGPLV description TRYPSIN_SER Serine proteases, trypsin family, serine active site. DScqGDSGGPLV source prosite : PS00135 15) chain A residue 45 type ACT_SITE sequence H description Charge relay system source Swiss-Prot : SWS_FT_FI1 16) chain A residue 96 type ACT_SITE sequence D description Charge relay system source Swiss-Prot : SWS_FT_FI1 17) chain A residue 197 type ACT_SITE sequence S description Charge relay system source Swiss-Prot : SWS_FT_FI1 18) chain A residue 144 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:9151681 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 143 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine source Swiss-Prot : SWS_FT_FI3

Display surface Download Links