eF-site ID 1fqt-A PDB Code 1fqt Chain A click to enlarge Title CRYSTAL STRUCTURE OF THE RIESKE-TYPE FERREDOXIN ASSOCIATED WITH BIPHENYL DIOXYGENASE Classification OXIDOREDUCTASE Compound RIESKE-TYPE FERREDOXIN OF BIPHENYL DIOXYGENASE Source null (BPHF_BURCE) Sequence A:  MKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQ DRCTHGDWSLSDGGYLEGDVVECSLHMGKFCVRTGKVKSP PPCEALKIFPIRIEDNDVLVDFEAGYLAP Description Functional site 1) chain A residue 43 type sequence C description BINDING SITE FOR RESIDUE FES A 1001 source : AC1 2) chain A residue 45 type sequence H description BINDING SITE FOR RESIDUE FES A 1001 source : AC1 3) chain A residue 46 type sequence G description BINDING SITE FOR RESIDUE FES A 1001 source : AC1 4) chain A residue 63 type sequence C description BINDING SITE FOR RESIDUE FES A 1001 source : AC1 5) chain A residue 66 type sequence H description BINDING SITE FOR RESIDUE FES A 1001 source : AC1 6) chain A residue 68 type sequence G description BINDING SITE FOR RESIDUE FES A 1001 source : AC1 7) chain A residue 84 type sequence E description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 8) chain A residue 85 type sequence A description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 9) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 10) chain A residue 36 type sequence L description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 11) chain A residue 45 type sequence H description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 12) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 13) chain A residue 91 type sequence I description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 14) chain A residue 93 type sequence I description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 15) chain A residue 43 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 45 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 63 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 66 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links