eF-site ID 1fni-A PDB Code 1fni Chain A click to enlarge Title CRYSTAL STRUCTURE OF PORCINE BETA TRYPSIN WITH 0.01% POLYDOCANOL Classification HYDROLASE Compound TRYPSIN Source ORGANISM_COMMON: pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence A:  IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAH CYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNT LDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISG WGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNM ICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQK NKPGVYTKVCNYVNWIQQTIAAN Description Functional site 1) chain A residue 41 type sequence F description BINDING SITE FOR RESIDUE SO4 A 422 source : AC1 2) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE SO4 A 422 source : AC1 3) chain A residue 128 type sequence C description BINDING SITE FOR RESIDUE SO4 A 422 source : AC1 4) chain A residue 192 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 422 source : AC1 5) chain A residue 193 type sequence G description BINDING SITE FOR RESIDUE SO4 A 422 source : AC1 6) chain A residue 195 type sequence S description BINDING SITE FOR RESIDUE SO4 A 422 source : AC1 7) chain A residue 70 type sequence E description BINDING SITE FOR RESIDUE CA A 423 source : AC2 8) chain A residue 72 type sequence N description BINDING SITE FOR RESIDUE CA A 423 source : AC2 9) chain A residue 75 type sequence V description BINDING SITE FOR RESIDUE CA A 423 source : AC2 10) chain A residue 77 type sequence E description BINDING SITE FOR RESIDUE CA A 423 source : AC2 11) chain A residue 80 type sequence E description BINDING SITE FOR RESIDUE CA A 423 source : AC2 12) chain A residue 37 type sequence S description BINDING SITE FOR RESIDUE EDO A 424 source : AC3 13) chain A residue 60 type sequence K description BINDING SITE FOR RESIDUE EDO A 424 source : AC3 14) chain A residue 61 type sequence S description BINDING SITE FOR RESIDUE EDO A 424 source : AC3 15) chain A residue 62 type sequence R description BINDING SITE FOR RESIDUE EDO A 424 source : AC3 16) chain A residue 164 type sequence S description BINDING SITE FOR RESIDUE EDO A 424 source : AC3 17) chain A residue 165 type sequence N description BINDING SITE FOR RESIDUE EDO A 424 source : AC3 18) chain A residue 166 type sequence S description BINDING SITE FOR RESIDUE EDO A 424 source : AC3 19) chain A residue 28 type sequence P description BINDING SITE FOR RESIDUE EDO A 425 source : AC4 20) chain A residue 116 type sequence S description BINDING SITE FOR RESIDUE EDO A 425 source : AC4 21) chain A residue 119 type sequence A description BINDING SITE FOR RESIDUE EDO A 425 source : AC4 22) chain A residue 151 type sequence Y description BINDING SITE FOR RESIDUE EDO A 426 source : AC5 23) chain A residue 178 type sequence G description BINDING SITE FOR RESIDUE EDO A 426 source : AC5 24) chain A residue 230 type sequence K description BINDING SITE FOR RESIDUE EDO A 426 source : AC5 25) chain A residue 233 type sequence N description BINDING SITE FOR RESIDUE EDO A 426 source : AC5 26) chain A residue 239 type sequence Q description BINDING SITE FOR RESIDUE EDO A 427 source : AC6 27) chain A residue 243 type sequence A description BINDING SITE FOR RESIDUE EDO A 427 source : AC6 28) chain A residue 53-58 type prosite sequence VSAAHC description TRYPSIN_HIS Serine proteases, trypsin family, histidine active site. VSAAHC source prosite : PS00134 29) chain A residue 189-200 type prosite sequence DSCQGDSGGPVV description TRYPSIN_SER Serine proteases, trypsin family, serine active site. DScqGDSGGPVV source prosite : PS00135 30) chain A residue 57 type ACT_SITE sequence H description Charge relay system source Swiss-Prot : SWS_FT_FI1 31) chain A residue 102 type ACT_SITE sequence D description Charge relay system source Swiss-Prot : SWS_FT_FI1 32) chain A residue 195 type ACT_SITE sequence S description Charge relay system source Swiss-Prot : SWS_FT_FI1 33) chain A residue 75 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 34) chain A residue 80 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 35) chain A residue 70 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 36) chain A residue 72 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 37) chain A residue 189 type SITE sequence D description Required for specificity => ECO:0000250 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links