eF-site ID 1fiq-A PDB Code 1fiq Chain A click to enlarge Title CRYSTAL STRUCTURE OF XANTHINE OXIDASE FROM BOVINE MILK Classification OXIDOREDUCTASE Compound XANTHINE OXIDASE Source ORGANISM_COMMON: cattle; ORGANISM_SCIENTIFIC: Bos taurus; Sequence A:  TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKL GCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLH HVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIV MSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFR TFAK Description Functional site 1) chain A residue 112 type sequence Q description BINDING SITE FOR RESIDUE FES A 601 source : AC1 2) chain A residue 113 type sequence C description BINDING SITE FOR RESIDUE FES A 601 source : AC1 3) chain A residue 114 type sequence G description BINDING SITE FOR RESIDUE FES A 601 source : AC1 4) chain A residue 116 type sequence C description BINDING SITE FOR RESIDUE FES A 601 source : AC1 5) chain A residue 148 type sequence C description BINDING SITE FOR RESIDUE FES A 601 source : AC1 6) chain A residue 149 type sequence R description BINDING SITE FOR RESIDUE FES A 601 source : AC1 7) chain A residue 150 type sequence C description BINDING SITE FOR RESIDUE FES A 601 source : AC1 8) chain A residue 42 type sequence G description BINDING SITE FOR RESIDUE FES A 602 source : AC2 9) chain A residue 43 type sequence C description BINDING SITE FOR RESIDUE FES A 602 source : AC2 10) chain A residue 44 type sequence G description BINDING SITE FOR RESIDUE FES A 602 source : AC2 11) chain A residue 46 type sequence G description BINDING SITE FOR RESIDUE FES A 602 source : AC2 12) chain A residue 47 type sequence G description BINDING SITE FOR RESIDUE FES A 602 source : AC2 13) chain A residue 48 type sequence C description BINDING SITE FOR RESIDUE FES A 602 source : AC2 14) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE FES A 602 source : AC2 15) chain A residue 51 type sequence C description BINDING SITE FOR RESIDUE FES A 602 source : AC2 16) chain A residue 71 type sequence N description BINDING SITE FOR RESIDUE FES A 602 source : AC2 17) chain A residue 73 type sequence C description BINDING SITE FOR RESIDUE FES A 602 source : AC2 18) chain A residue 112 type sequence Q description BINDING SITE FOR RESIDUE MTE C 1333 source : AC3 19) chain A residue 150 type sequence C description BINDING SITE FOR RESIDUE MTE C 1333 source : AC3 20) chain A residue 45 type sequence E description BINDING SITE FOR RESIDUE FAD B 606 source : AC6 21) chain A residue 46 type sequence G description BINDING SITE FOR RESIDUE FAD B 606 source : AC6 22) chain A residue 148 type ACT_SITE sequence C description Proton acceptor => ECO:0000269|PubMed:15148401 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 150 type ACT_SITE sequence C description Proton acceptor => ECO:0000269|PubMed:15148401 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 43-51 type prosite sequence CGEGGCGAC description 2FE2S_FER_1 2Fe-2S ferredoxin-type iron-sulfur binding region signature. CGEGGCGAC source prosite : PS00197

Display surface Download Links