eF-site ID 1ffv-D PDB Code 1ffv Chain D click to enlarge Title CARBON MONOXIDE DEHYDROGENASE FROM HYDROGENOPHAGA PSEUDOFLAVA Classification HYDROLASE Compound CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE Source ORGANISM_SCIENTIFIC: Hydrogenophaga pseudoflava; Sequence D:  AKKIITVNVNGKAQEKAVEPRTLLIHFLREELNLTGAHIG CETSHCGACTVDIDGRSVKSCTHLAVQCDGSEVLTVEGLA NKGVLHAVQEGFYKEHGLQCGFCTPGMLMRAYRFLQENPN PTEAEIRMGMTGNLCRCTGYQNIVKAVQYAARKLQE Description Functional site 1) chain D residue 100 type sequence Q description BINDING SITE FOR RESIDUE FES D 1909 source : AC3 2) chain D residue 101 type sequence C description BINDING SITE FOR RESIDUE FES D 1909 source : AC3 3) chain D residue 102 type sequence G description BINDING SITE FOR RESIDUE FES D 1909 source : AC3 4) chain D residue 104 type sequence C description BINDING SITE FOR RESIDUE FES D 1909 source : AC3 5) chain D residue 136 type sequence C description BINDING SITE FOR RESIDUE FES D 1909 source : AC3 6) chain D residue 137 type sequence R description BINDING SITE FOR RESIDUE FES D 1909 source : AC3 7) chain D residue 138 type sequence C description BINDING SITE FOR RESIDUE FES D 1909 source : AC3 8) chain D residue 41 type sequence G description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 9) chain D residue 42 type sequence C description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 10) chain D residue 45 type sequence S description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 11) chain D residue 46 type sequence H description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 12) chain D residue 47 type sequence C description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 13) chain D residue 48 type sequence G description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 14) chain D residue 50 type sequence C description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 15) chain D residue 60 type sequence K description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 16) chain D residue 62 type sequence C description BINDING SITE FOR RESIDUE FES D 1910 source : AC4 17) chain D residue 100 type sequence Q description BINDING SITE FOR RESIDUE PCD E 1921 source : AC6 18) chain D residue 138 type sequence C description BINDING SITE FOR RESIDUE PCD E 1921 source : AC6 19) chain D residue 45 type sequence S description BINDING SITE FOR RESIDUE FAD F 1923 source : AC8 20) chain D residue 47 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 21) chain D residue 50 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 22) chain D residue 62 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 23) chain D residue 101 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 24) chain D residue 104 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 25) chain D residue 136 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 26) chain D residue 138 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 27) chain D residue 42 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links