eF-site ID 1fb7-A PDB Code 1fb7 Chain A click to enlarge Title CRYSTAL STRUCTURE OF AN IN VIVO HIV-1 PROTEASE MUTANT IN COMPLEX WITH SAQUINAVIR: INSIGHTS INTO THE MECHANISMS OF DRUG RESISTANCE Classification HYDROLASE/HYDROLASE INHIBITOR Compound HIV-1 PROTEASE Source null (Q72874_9HIV1) Sequence A:  PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPG RWKPKMIVGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLMTQIGCTLNF Description Functional site 1) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 2) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 3) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 4) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 5) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 6) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 7) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 8) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 9) chain A residue 48 type sequence V description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 10) chain A residue 48 type sequence V description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 11) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 12) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 13) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 14) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 15) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 16) chain A residue 82 type sequence V description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 17) chain A residue 82 type sequence V description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 18) chain A residue 84 type sequence I description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 19) chain A residue 84 type sequence I description BINDING SITE FOR RESIDUE ROC A 100 source : AC1 20) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141 21) chain A residue 25 type catalytic sequence D description 175 source MCSA : MCSA1 22) chain A residue 26 type catalytic sequence T description 175 source MCSA : MCSA1 23) chain A residue 27 type catalytic sequence G description 175 source MCSA : MCSA1 24) chain A residue 25 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094, ECO:0000305|PubMed:33542150 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 99 type SITE sequence F description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links