eF-site ID 1fa4_12-A PDB Code 1fa4 Model 12 Chain A click to enlarge Title ELUCIDATION OF THE PARAMAGNETIC RELAXATION OF HETERONUCLEI AND PROTONS IN CU(II) PLASTOCYANIN FROM ANABAENA VARIABILIS Classification ELECTRON TRANSPORT Compound PLASTOCYANIN Source ORGANISM_SCIENTIFIC: Anabaena variabilis; Sequence A:  ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHN VVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADA PAGEYTFYCEPHRGAGMVGKITVAG Description Functional site 1) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE CU A 106 source : AC1 2) chain A residue 89 type sequence C description BINDING SITE FOR RESIDUE CU A 106 source : AC1 3) chain A residue 92 type sequence H description BINDING SITE FOR RESIDUE CU A 106 source : AC1 4) chain A residue 97 type sequence M description BINDING SITE FOR RESIDUE CU A 106 source : AC1 5) chain A residue 73 type BINDING sequence S description BINDING => ECO:0000269|DOI:10.1021/ja001368z source Swiss-Prot : SWS_FT_FI1 6) chain A residue 89 type BINDING sequence C description BINDING => ECO:0000269|DOI:10.1021/ja001368z source Swiss-Prot : SWS_FT_FI1 7) chain A residue 92 type BINDING sequence H description BINDING => ECO:0000269|DOI:10.1021/ja001368z source Swiss-Prot : SWS_FT_FI1 8) chain A residue 97 type BINDING sequence M description BINDING => ECO:0000269|DOI:10.1021/ja001368z source Swiss-Prot : SWS_FT_FI1 9) chain A residue 82-97 type prosite sequence AGEYTFYCEPHRGAGM description COPPER_BLUE Type-1 copper (blue) proteins signature. AgeYtFYCe.P.HrgagM source prosite : PS00196

Display surface Download Links