eF-site ID 1f1f-A PDB Code 1f1f Chain A click to enlarge Title CRYSTAL STRUCTURE OF CYTOCHROME C6 FROM ARTHROSPIRA MAXIMA Classification ELECTRON TRANSPORT Compound CYTOCHROME C6 Source ORGANISM_SCIENTIFIC: Arthrospira maxima; Sequence A:  DVAAGASVFSANCAACHMGGRNVIVANKTLSKSDLAKYLK GFDDDAVAAVAYQVTNGKNAMPGFNGRLSPLQIEDVAAYV VDQAEKGW Description (1)  CYTOCHROME C6 FROM ARTHROSPIRA MAXIMA Functional site 1) chain A residue 13 type sequence N description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 2) chain A residue 14 type sequence C description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 3) chain A residue 17 type sequence C description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 4) chain A residue 18 type sequence H description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 5) chain A residue 23 type sequence N description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 6) chain A residue 29 type sequence K description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 7) chain A residue 30 type sequence T description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 8) chain A residue 31 type sequence L description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 9) chain A residue 35 type sequence D description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 10) chain A residue 36 type sequence L description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 11) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 12) chain A residue 54 type sequence Q description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 13) chain A residue 55 type sequence V description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 14) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 15) chain A residue 60 type sequence N description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 16) chain A residue 61 type sequence A description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 17) chain A residue 62 type sequence M description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 18) chain A residue 86 type sequence E description BINDING SITE FOR RESIDUE HEC A 200 source : AC1 19) chain A residue 14 type BINDING sequence C description covalent => ECO:0000269|PubMed:11478889, ECO:0000269|PubMed:12077429 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 17 type BINDING sequence C description covalent => ECO:0000269|PubMed:11478889, ECO:0000269|PubMed:12077429 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 9-39 type prosite sequence VFSANCAACHMGGRNVIVANKTLSKSDLAKY description HMA_1 Heavy-metal-associated domain. VfSAnCaAChmgGRnvIvanktlsksdlAkY source prosite : PS01047 22) chain A residue 18 type BINDING sequence H description axial binding residue => ECO:0000269|PubMed:11478889, ECO:0000269|PubMed:12077429 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 62 type BINDING sequence M description axial binding residue => ECO:0000269|PubMed:11478889, ECO:0000269|PubMed:12077429 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links