eF-site ID 1ey7-A PDB Code 1ey7 Chain A click to enlarge Title STRUCTURE OF S. NUCLEASE STABILIZING MUTANT S128A Classification HYDROLASE Compound STAPHYLOCOCCAL NUCLEASE Source null (NUC_STAAU) Sequence A:  LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKH PKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYG RGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR KAEAQAKKEKLNIWS Description Functional site 1) chain A residue 21 type catalytic sequence D description 165 source MCSA : MCSA1 2) chain A residue 35 type catalytic sequence R description 165 source MCSA : MCSA1 3) chain A residue 40 type catalytic sequence D description 165 source MCSA : MCSA1 4) chain A residue 41 type catalytic sequence T description 165 source MCSA : MCSA1 5) chain A residue 43 type catalytic sequence E description 165 source MCSA : MCSA1 6) chain A residue 87 type catalytic sequence R description 165 source MCSA : MCSA1 7) chain A residue 35 type ACT_SITE sequence R description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 43 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 87 type ACT_SITE sequence R description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 19-43 type prosite sequence DGDTVKLMYKGQPMTFRLLLVDTPE description TNASE_1 Thermonuclease family signature 1. DGDTVkLmykgqpmtf.RLllVDtPE source prosite : PS01123 11) chain A residue 83-93 type prosite sequence DKYGRGLAYIY description TNASE_2 Thermonuclease family signature 2. DKYGRgLAyIY source prosite : PS01284 12) chain A residue 41 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2 13) chain A residue 21 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 14) chain A residue 40 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links